Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

90 sport adventure Vektor Designs für T-Shirts und Merch

Downloade & kaufe bearbeitbare sport adventure AI Vektorgrafiken für T-Shirts, Telefonhüllen, Buchcovers und andere Artikel Merch

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VXL15

Sand in meinem Stiefel-Wander-T-Shirt-Design

Editierbarer Text

Check out this cool t-shirt design for people who loves hiking including the quote 'All I brought back with me was sand in my boots'

Paragliding Adventure Sport T-Shirt Design

Editierbarer Text

Awesome t-shirt design featuring a person paragliding and the quote "Speedflying let's shred"

Yeti Santa Claus Snowboard-Abenteuer-T-Shirt-Design

Eye-catching t-shirt design featuring a Yeti Santa Claus having a blast while snowboarding

Mountain Climber Adventure Lifestyle T-Shirt Design

Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Paragliding Sonnenuntergang T-Shirt Design

Beautiful t-shirt design that features a person paragliding during the sunset

Bigfoot-Skiabenteuer-T-Shirt-Design

Humorous t-shirt design showing a cartoon Bigfoot skiing downhill, blending cryptozoology with winter sports

Lebensabenteuer Wandern T-Shirt Design

Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Surfer für flache Wassersportarten

Editable design featuring tons of different water sports silhouettes and backgrounds to choose from

Skibrillen-T-Shirt-Design

Cool t-shirt design with a mountain reflection in ski goggles

E-Bike-Abenteuer-T-Shirt-Design

Editierbarer Text

Check out this cool t-shirt design for electronic bikers including a man riding his bike through the forest and the German quote 'Yes, everything's alright'

Mountainbike-Vintage-T-Shirt-Design

Retro-styled t-shirt design with a mountain bike theme

Skateboard-Kunst-T-Shirt-Design

Editierbarer Text

Captivating t-shirt design with the quote; "Skateboarding: The Art of Defying Gravity"

Wander-Tracking-Log-Vorlage KDP-Innenarchitektur

Cool hiking themed tracking log

Skifahrendes Pinguin-T-Shirt-Design

Cute t-shirt design with an animated penguin enjoying skiing, perfect for winter sport enthusiasts

Ski-Party-Crew-T-Shirt-Design

Editierbarer Text

Adventurous t-shirt design showcasing a hen character for a "Ski-Hennen JGA Party Crew", with a ski-themed caricature

Downhill Biking T-Shirt Design

T-shirt design featuring a downhill biker and the quote saying DOWHILL IS MY THRILL

Leben Sie auf dem T-Shirt-Design des engen Seils des Bandes

Editierbarer Text

Look at this cool t-shirt design for tight rope fans including a person's silhouette in a retro sunset background and the quote 'Live on tape'

Lustiges Schneebrillen-T-Shirt Design

T-shirt design featuring snow goggles with a mountain on top of it and a smile under it

Handgezeichneter Satz der Quad-Biker

Black and white hand drawn illustration set that features three professional quad bikers doing jump tricks

Taucher, der das Ozean-T-Shirt-Design erforscht

Look at this cool t-shirt including a scuba diver exploring under the sea! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Sommer-Strandschirm-T-Shirt-Design

Editierbarer Text

This playful t-shirt design features a beach umbrella with a striking striped pattern in red and white

Taucher im Ozean-T-Shirt-Design

Check out this cool t-shirt design of a diver exploring the ocean! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Surf-Van-T-Shirt-Design

Check out this great t-shirt design including a surfing van and some surfboards! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Sieben Gipfel Berg T-Shirt Design

T-shirt design featuring the seven highest mountain summits

Französisches Bucheinbanddesign

Editierbarer Text

Cool book cover design featuring geometrical diamond shapes

Langlauf-T-Shirt-Design

Editierbarer Text

Intriguing t-shirt design with a Nordic deity motif merged with a skiing theme, and the text "Pray for Snow"

Lustiges Wanderer-Zitat-T-Shirt-Design

Editierbarer Text

A black t-shirt design with the phrase "Be nice to hikers they know places you'll never be found" in bold, white letters

Gleitschirm T-Shirt Design

Cool t-shirt design consisting of a person paragliding

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

3 Skisportlabels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

T-Shirt-Design für Retro-Skibegeisterte

Retro-style t-shirt design showcasing a dynamic skier silhouette within a circular frame, with the text "I'd rather be skiing"

Mountainbiker-Silhouette-T-Shirt-Design

Dynamic t-shirt design featuring a silhouette of a mountain biker performing a dab against a vibrant yellow splash backdrop

Wandern Abenteuer Berge Illustration

Adventure illustration featuring a human silhouette doing hiking

Quad Biker schwarz gesetzt

Black and white illustration set that features three quads and three bikers doing different tricks

Familie im T-Shirt-Design der Berge

Look at this adorable t-shirt design of a family exploring the mountains! This Graphic Tee design can be used on shirts, mugs, posters, hoodies and other merch products

Quad Biker Illustrationsset

Illustration set featuring three colored quads in different positions and bikers doing various tricks

Anpassbares Design für den Wintersport

Editable design featuring tons of different winter sports silhouettes and backgrounds to choose from

Bungee springende Silhouette eingestellt

Amazing set comprised of several silhouettes of people practicing bungee jumping, an activity where a person jumps from a great height while connected to a large elastic cord

Klettern heilt das Seelen-T-Shirt-Design

Watch this amazing t-shirt design of a woman climbing a stone wall and the quote 'Climbing heals the soul'

6 Extremsportabzeichen

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

T-Shirt Design für den Skiaufseher

Editierbarer Text

Sporty t-shirt design with ski goggles reflecting mountains and skier silhouettes, with the text "Skihasen supervisor 1st hour free"

Paddeln Sie auf Rafting-T-Shirt-Design

Editierbarer Text

Look at this adventurous t-shirt design including a rafting boat and the quote 'Leave the road & paddle on'

Lass uns Ski-T-Shirt-Design fahren

Editierbarer Text

Dynamic t-shirt design showcasing an intrepid skier

ATV-Straßenabzeichen gesetzt

Set of 6 badges featuring different all-terrain vehicles with quotes that read "of the road" "extreme team" "road adventure" and more! Juego de 6 insignias con diferentes vehiculos todo terreno con citas que dicen "de la carretera" "equipo extremo" "aventura en la carretera" y mas! Conjunto de 6 emblemas com diferentes veiculos todo-o-terreno com citacoes que dizem "da estrada" "equipe extrema" "aventura na estrada" e muito mais! Set mit 6 Abzeichen mit verschiedenen Gelandefahrzeugen mit Zitaten wie "von der Strae" "extremes Team" "Straenabenteuer" und mehr!

T-Shirt-Design mit surfenden Seelen

Editierbarer Text

Edgy t-shirt design showcasing a zombie surfer riding a wave over multiple skulls with text about surfing souls

Red Hood Snowboard T-Shirt Design

T-shirt design feauring an illustration of Red Hood snowboarding out of a Wolf-like snow mountain

Wintersporturlaub Banner

Cool flat style winter sports banner with winter elements like ski snowboard gloves and more

T-Shirt-Design mit unerschrockenem Hai beim Surfen

Editierbarer Text

Dynamic t-shirt design showing a shark riding a surfboard on a wave, with text about breaking rules in the ocean

Parkour Runner T-Shirt Design

T-shirt design featuring a parkour runner jumping from building to building

Quad Biker Illustration Design

Awesome illustration design that features a man wearing an orange suit and a helmet riding a blue all-terrain vehicle

von 2

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch