Registrieren
Einloggen
Vexels Logo
All
Zufällige Suche

104 skifahren Vektor Designs für T-Shirts und Merch

Downloade & kaufe bearbeitbare skifahren AI Vektorgrafiken für T-Shirts, Telefonhüllen, Buchcovers und andere Artikel Merch

Gesponserte Ergebnisse vonShutterstock Logo
Erhalten Sie 15% Rabatt mit dem Code: VXL15

Skifahrentiere werfen Kissenentwurf

for Mercht-shirt icon
Druckfertig
Awesome throw pillow design that features different winter animals skiing in the snow

Ski Kerl T-Shirt Design

for Mercht-shirt icon
Druckfertig
Great t-shirt design featuring a man skiing in a triangular composition with snowy pines

Lustiges Schneebrillen-T-Shirt Design

for Mercht-shirt icon
Druckfertig
T-shirt design featuring snow goggles with a mountain on top of it and a smile under it

Winterlandschaften und Ski-T-Shirt-Design

for Mercht-shirt icon
Editierbarer Text
Druckfertig
Amazing t-shirt design that features people skiing and the quote "Winter landscape lovers"

Schneekaninchen Deutsches T-Shirt Design

for Mercht-shirt icon
Inhalt auf Deutsch
Druckfertig
T-shirt design featuring snow goggles with bunny ears and the quote in German ICH BIN EIN SKIHASERL (I AM A SNOW BUNNY) Use this print ready design for tshirts posters mug hoodies and other merch products

Ski Stunts Sport Zitat T-Shirt Design

for Mercht-shirt icon
Inhalt auf Deutsch
Druckfertig
Cool t-shirt design of a person skiing and a german quote that translates to "I do my own stunts"

Langlauf-T-Shirt-Design

for Mercht-shirt icon
Editierbarer Text
Druckfertig
Intriguing t-shirt design with a Nordic deity motif merged with a skiing theme, and the text "Pray for Snow"

Ski T-Rex T-Shirt Design

for Mercht-shirt icon
Druckfertig
T-shirt design that features an illustration of a T-rex skiing with the quote "Ski-rex"

Erdmännchen Ski T-Shirt Design

for Mercht-shirt icon
Druckfertig
Great t-shirt design featuring a skiing meerkat in hand-drawn style, with abstract shapes in the background

Mountain Ski Brillen Design

Graphic design of snow goggles with a mountain reflected on its surface

Papa-Skifahrer-Tassen-Design

for Mercht-shirt icon
Editierbarer Text
Druckfertig
Action-packed mug design showcasing a vibrant illustration of a skier, perfect for winter sports fans and as a gift for dads who ski

Skiszenen Design Set

Premiumcrown icon
Beautiful illustration set that includes four different ski scenes featuring a snowboard ski lifts skis and more! Each design can be used separately

Winter People Simple Stroke Design Kollektion

Premiumcrown icon
People design collection featuring people in different winter activities

T-Shirt-Design mit Zitaten von Skikühen

for Mercht-shirt icon
Kawaii t-shirt design showing three baby cows skiing with German speech bubbles saying "Fancy skiing", "Moo ski!"

Buntes Mustermuster des Winters

Premiumcrown icon
Nahtlose Muster
Nice Winter themed pattern design featuring colorful trees and people skiing

Man Jumping Mountain Skifahren

Extreme sports concept background representing a man skiing on the mountain by jumping in the air through the snow holding ski poles

Skiausrüstung Schwarz-Weiß-Set

Premiumcrown icon
Incredible collection of ski equipment design elements featuring boots gloves glasses helmet ski poles and more

Ski Queen T-Shirt Design

for Mercht-shirt icon
Druckfertig
T-shirt design featuring a female skiier with the quote SKI QUEEN behind her

Ski Bergsport T-Shirt Design

for Mercht-shirt icon
Druckfertig
Fun t-shirt design featuring a person skiing down a snowy mountain

Katze Skibrille T-Shirt Design

for Mercht-shirt icon
Druckfertig
Amazing t-shirt design featuring a cat wearing ski glasses

Skifahrer Schwein T-Shirt Design

for Mercht-shirt icon
Druckfertig
Cool t-shirt design that features an illustration of a pig skiing

Ski Eule T-Shirt Design

for Mercht-shirt icon
Druckfertig
Cool t-shirt design featuring an own dressed in ski attire

Flat Minimal Sports Icon Pack

Flat and minimal style set of 20 different sporting icons in black color

Tiere Winterferien schüren eingestellt

Premiumcrown icon
Cute Winter set featuring a stroke style polar bear a fox and a raccoon in different holidays activities

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Ski Menschen Illustration Set

Premiumcrown icon
Amazing illustration set in black and white featuring multiple people in different skiing positions

Hässlicher Pullover Ski T-Shirt Design

for Mercht-shirt icon
Druckfertig
Amazing t-shirt featuring an ugly sweater design with a man skiing

Buntes Skipaar-Illustrationsset

Premiumcrown icon
Illustration set featuring various pairs of skis of different sizes shapes and colors

Rollenspiel-Würfel-Ski-T-Shirt-Design

for Mercht-shirt icon
Editierbarer Text
Druckfertig
Fun t-shirt design featuring a role playing dice skiing down a mountain and the quote "Winter roll dices"

Weißes T-Shirt-Design mit Ski-Silhouette

for Mercht-shirt icon
Editierbarer Text
Druckfertig
Cool t-shirt design featuring a silhouette skiing down a mountain

Norwegen handgezeichnete Elemente Pack

Premiumcrown icon
Elements design pack featuring various Norway hand drawn elements

Ski-Abzeichen-Design-Set

Premiumcrown icon
Amazing badge design set that features different skiing badges with quotes such as "Let it snow" "Skiing life" "Ski on" and more! Enjoy! Increible conjunto de diseno de insignias que presenta diferentes insignias de esqui con citas como "Let it snow", "Skiing life", "Ski on" y mas! Disfrutar! Incrivel conjunto de design de crachas que apresenta diferentes crachas de esqui com citacoes como "Deixe nevar" "Vida de esqui" "Esquiar" e muito mais! Aproveitar! Erstaunliches Abzeichen-Design-Set mit verschiedenen Ski-Abzeichen mit Zitaten wie Let it snow, Skiing life, Ski on und mehr! Genieen!

T-Shirt-Design der Skiregenbogenbrille

for Mercht-shirt icon
Druckfertig
Wonderful t-shirt design featuring ski goggles with rainbow colors

Retro Cable Car T-Shirt Design

for Mercht-shirt icon
Druckfertig
T-shirt design featuring a cable car in a retro poster style with the text RETRO CABLE CAR

40 Wintersport-Silhouetten

This is a big set with 40 silhouettes related to winter sports: skiing snowboarding ice skating hockey snowmobile racing etc

Ski Löwe T-Shirt Design

for Mercht-shirt icon
Druckfertig
Awesome t-shirt design featuring a lion wearing ski gear

3 Skisportlabels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Snowboard Wintersport T-Shirt Design

for Mercht-shirt icon
Druckfertig
Cool t-shirt design featuring a person snowboarding with the quote "If snowboarding was easy they's call it skiing"

Hand gezeichnete Norwegen farbige Elemente Set

Premiumcrown icon
Colored elements set featuring various Norway elements in illustrated style

Sport-Silhouette-Sammlung

Huge collection of various sports silhouettes

Skiausrüstung Elemente gesetzt

Premiumcrown icon
Collection of ski equipment design elements featuring boots

Buntes Design des Skis

This beautiful and colorful design show a man skiing making a jump

Tiere Winterferien eingestellt

Premiumcrown icon
Cute flat style vector set featuring six animals with winter clothes in different holidays activities

Winterski-Themenmuster

Nice seamless seasonal winter pattern featuring winter clothing snowflakes and mountain icons

Weihnachtskarikatur Charakter großer Satz

Merry Christmas dudes! This is a huge set of Christmas cartoon characters that includes Santa Claus children elf reindeer Christmas elements and much more

6 Extremsportabzeichen

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Mountain Skiinig Illustration Design

Cool sports themed design featuring an illustration of a man skiing wearing grey jacket and red pants on a snowy mountain landscape

Flache Illustration der Winterschneeszene

Premiumcrown icon
Flat illustration of a winter snowy scene featuring people in different activities and the quote TIME FOR WINTER

Schneesport-Silhouetten eingestellt

Snow sports silhouettes set

Schweiz Stroke Icons Design Pack

Premiumcrown icon
Icon design pack featuring various Swiss icons in stroke style
von 3
Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch
PLÄNE ANSEHEN