Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

104 skifahren Vektor Designs für T-Shirts und Merch

Downloade & kaufe bearbeitbare skifahren AI Vektorgrafiken für T-Shirts, Telefonhüllen, Buchcovers und andere Artikel Merch

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VEXELS15

Ski T-Rex T-Shirt Design

T-shirt design that features an illustration of a T-rex skiing with the quote "Ski-rex"

Erdmännchen Ski T-Shirt Design

Great t-shirt design featuring a skiing meerkat in hand-drawn style, with abstract shapes in the background

Winterlandschaften und Ski-T-Shirt-Design

Editierbarer Text

Amazing t-shirt design that features people skiing and the quote "Winter landscape lovers"

Ski Bergsport T-Shirt Design

Fun t-shirt design featuring a person skiing down a snowy mountain

Skifahrentiere werfen Kissenentwurf

Awesome throw pillow design that features different winter animals skiing in the snow

Retro Cable Car T-Shirt Design

T-shirt design featuring a cable car in a retro poster style with the text RETRO CABLE CAR

Jagd auf das kalte T-Shirt-Design

Editierbarer Text

Amazing t-shirt design that features a bear skiing and the quote "Chasing the cold"

Ski Eule T-Shirt Design

Cool t-shirt design featuring an own dressed in ski attire

Papa-Skifahrer-Tassen-Design

Editierbarer Text

Action-packed mug design showcasing a vibrant illustration of a skier, perfect for winter sports fans and as a gift for dads who ski

Rollenspiel-Würfel-Ski-T-Shirt-Design

Editierbarer Text

Fun t-shirt design featuring a role playing dice skiing down a mountain and the quote "Winter roll dices"

Langlauf-T-Shirt-Design

Editierbarer Text

Intriguing t-shirt design with a Nordic deity motif merged with a skiing theme, and the text "Pray for Snow"

T-Shirt-Design mit vitruvianischer Biathleten-Silhouette

Conceptual t-shirt design with a Vitruvian man-inspired biathlete silhouette

T-Shirt-Design mit Zitaten von Skikühen

Kawaii t-shirt design showing three baby cows skiing with German speech bubbles saying "Fancy skiing", "Moo ski!"

Snowboard Wintersport T-Shirt Design

Cool t-shirt design featuring a person snowboarding with the quote "If snowboarding was easy they's call it skiing"

Skifahren Sport Colorado Muster Design

Nahtlose Muster

Great pattern design depicting elements related to colorado state, such as the flag, beer and skiing

Skifahren Wintersport mit Silhouette-Set

Awesome sport-themed set that features a series of silhouettes of people skiing in extreme poses

Man Jumping Mountain Skifahren

Extreme sports concept background representing a man skiing on the mountain by jumping in the air through the snow holding ski poles

Sport-Silhouette-Sammlung

Huge collection of various sports silhouettes

Buntes Design des Skis

This beautiful and colorful design show a man skiing making a jump

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

40 Wintersport-Silhouetten

This is a big set with 40 silhouettes related to winter sports: skiing snowboarding ice skating hockey snowmobile racing etc

Skifahrer Silhouette Set

Amazing set design that features various people skiing in different positions all in silhouette style

Wintersport-Silhouette-Set

Cool silhouette set design that features people doing different winter sports like snowboarding and skiing

3 Skisportlabels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Winter-Tierfiguren-Musterdesign

Nahtlose Muster

Amazing pattern design that features cute winter animals skiing and snow

Menschen, die mit hundetierset trainieren

Amazing animal-themed set that features several people doing different sports with dogs, such as running, using a bike and skiing

Skiausrüstung Schwarz-Weiß-Set

Incredible collection of ski equipment design elements featuring boots gloves glasses helmet ski poles and more

Ski Menschen Illustration Set

Amazing illustration set in black and white featuring multiple people in different skiing positions

Silhouetten von Menschen, die im Winter Ski fahren

Amazing sport-themed set that features a series of silhouettes of people skiing in different extreme poses

6 Extremsportabzeichen

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Weihnachtskarikatur Charakter großer Satz

Merry Christmas dudes! This is a huge set of Christmas cartoon characters that includes Santa Claus children elf reindeer Christmas elements and much more

Ski-Abzeichen-Design-Set

Amazing badge design set that features different skiing badges with quotes such as "Let it snow" "Skiing life" "Ski on" and more! Enjoy! Increible conjunto de diseno de insignias que presenta diferentes insignias de esqui con citas como "Let it snow", "Skiing life", "Ski on" y mas! Disfrutar! Incrivel conjunto de design de crachas que apresenta diferentes crachas de esqui com citacoes como "Deixe nevar" "Vida de esqui" "Esquiar" e muito mais! Aproveitar! Erstaunliches Abzeichen-Design-Set mit verschiedenen Ski-Abzeichen mit Zitaten wie Let it snow, Skiing life, Ski on und mehr! Genieen!

Ski-Wintersport-Icon-Elemente gesetzt

Skiszenen Design Set

Beautiful illustration set that includes four different ski scenes featuring a snowboard ski lifts skis and more! Each design can be used separately

Flat Minimal Sports Icon Pack

Buntes Skipaar-Illustrationsset

Illustration set featuring various pairs of skis of different sizes shapes and colors

Skiausrüstung Elemente gesetzt

Collection of ski equipment design elements featuring boots

Ski im schneebedeckten Berg

Cool illustration of a snowy mountain landscape with a guy skiing and mountain cabin

Design des Buchumschlags für Skisportler

Editierbarer Text

Amazing book cover design featuring a person doing a cool skiing trick

Winter People Simple Stroke Design Kollektion

People design collection featuring people in different winter activities

Mountain Skiinig Illustration Design

Cool sports themed design featuring an illustration of a man skiing wearing grey jacket and red pants on a snowy mountain landscape

Mountain Ski Brillen Design

Graphic design of snow goggles with a mountain reflected on its surface

Hand gezeichnete Norwegen farbige Elemente Set

Colored elements set featuring various Norway elements in illustrated style

Norwegen handgezeichnete Elemente Pack

Elements design pack featuring various Norway hand drawn elements

Winterski-Themenmuster

Nice seamless seasonal winter pattern featuring winter clothing snowflakes and mountain icons

Schweiz Stroke Icons Design Pack

Icon design pack featuring various Swiss icons in stroke style

Tiere Winterferien eingestellt

Cute flat style vector set featuring six animals with winter clothes in different holidays activities

Tiere Winterferien schüren eingestellt

Cute Winter set featuring a stroke style polar bear a fox and a raccoon in different holidays activities

Flache Illustration der Winterschneeszene

Flat illustration of a winter snowy scene featuring people in different activities and the quote TIME FOR WINTER

Sport Vektor

Sports vector design in encapsulated postscript

von 3

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch