Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

1634 adventure Vektor Designs für T-Shirts und Merch

Downloade & kaufe bearbeitbare adventure AI Vektorgrafiken für T-Shirts, Telefonhüllen, Buchcovers und andere Artikel Merch

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VEXELS15

Seeker man illustration

Wir haben keine adventure Vektoren, aber hier sind alle unsere adventure Designs oder Design hier anfordern

Klassisches Motorrad-Line-Art-Design für Bekleidung PNG-Design

Striking motorcycle design featuring a detailed line art style

Verspieltes Tiger-Surf-Design PNG-Design

Vibrant and whimsical, this illustration features a cute, cartoon-style tiger relaxed on a surfboard, merging playfulness with ocean vibes

Dynamisches Snowboard-Silhouette-Design PNG-Design

Striking snowboard silhouette design showcasing an athlete performing a trick mid-air

Dynamisches Snowboard-Silhouette-Design PNG-Design

Stylish and modern, this graphic design features a striking silhouette of a snowboarder in mid-action

Verspielte Katzen-Astronautenillustration PNG-Design

Charming and whimsical, this digital illustration features a cat dressed as an astronaut, complete with a space helmet and protective suit

Abstrakte Naturszene mit Bäumen und Mond-T-Shirt-Design PNG-Design

Charming digital illustration portraying a serene mountain landscape

Verspieltes Flamingo-Design im Strandstil PNG-Design

Playful t-shirt design featuring a distinctive flamingo in flight, surrounded by stylized stars

Verspieltes Geburtstagszitat-Design PNG-Design

Dynamic and lively, this design features the phrase 'Another lap around the sun' prominently displayed in bold, expressive typography

Dynamisches Motorradhelm-Design mit motivierendem Zitat PNG-Design

Bold and striking, this design features a motorcycle helmet with wings, symbolizing freedom and speed

Bärenillustration mit anpassbarem Text T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Striking t-shirt design featuring a detailed bear illustration in a powerful pose

Logo-Design für Vintage-Fahrten PNG-Design

Charmantes Happy Camper-Zitat-Design PNG-Design

Playful t-shirt design featuring the phrase 'Happy Campers' in whimsical script

Futuristisches Astronautendesign mit Universumstour-Thema T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Vibrant and captivating poster design featuring a detailed illustration of a female astronaut in a space helmet

Verspieltes Design im Flamingo-Strandstil PNG-Design

Vibrant and playful, this graphic design features a whimsical pink flamingo soaring through a starry sky

Futuristisches Hundetruppen-Design mit einem Weltraumhund T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Bold digital illustration showcasing a stylized dog character wearing advanced headphones and a sleek helmet

Retro-Videospielkunst mit Weltraummonstern T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Playful t-shirt design showcasing vibrant illustrations of space monsters and a heroic character

Elegantes kostenloses Vogelzitat-Design T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Striking and whimsical, this poster design features two birds in flight, symbolizing freedom

Aufwendiges Elchschädel-Design mit Naturmotiv T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Striking and detailed, this t-shirt design features an intricate illustration of a moose skull adorned with foliage and antlers

Verspieltes Pferde-Radsport-Design mit motivierenden Zitaten T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Dynamic and playful, this t-shirt design features a cartoon horse character energetically riding a bicycle

Malvorlage Fantasy-Prinzessin und Einhorn PNG-Design

Playful coloring page featuring a whimsical princess riding a unicorn

Tulum Strandparadies Reiseplakat T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Vibrant travel poster design showcasing Tulum's enchanting seaside landscape

Rallye-Auto-Design mit kräftiger Typografie T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Dynamic rally car design featuring a classic racing vehicle in motion

Weltraumreise Astronauten Design T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Bold graphic design featuring an astronaut in a space suit, surrounded by a globe motif

Grafikdesign für Astronauten beim Surfen T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Playful and adventurous, this poster design features an astronaut skillfully surfing a vibrant wave

Charmantes Lagerfeuer-Zitat-Design T-Shirt-Designvorlage

Edit Online Badge

Online bearbeiten

Playful t-shirt design featuring the quote 'Life is better by a bonfire'

Kraftvoller Krieger im E-Gitarren-Design PNG-Design

Dynamic and bold, this illustration features a muscular warrior raising an electric guitar that resembles a weapon

Verspieltes Cartoon-Snowboarder-Design PNG-Design

Charming and whimsical, this illustration features a cartoon character expertly snowboarding down a slope

Künstlerische Darstellung von untergetauchten Figuren im Wasser PNG-Design

Contemporary and evocative, this poster design features a unique depiction of two legs sticking out of the water, surrounded by submerged heads

Verspieltes Herzballon-Design PNG-Design

Playful hot air balloon design featuring vibrant pink colors and detailed heart motifs

Verspieltes Roller-Design mit flammenden Rädern PNG-Design

Vibrant and playful, this digital illustration features a scooter in bold pink, complete with fiery flames shooting from its wheels

Ikonisches Bigfoot-Silhouette-Design PNG-Design

Bold graphic design featuring a walking bigfoot silhouette, perfect for T-shirts or wall art

HyggeRelaxElements - 4 PNG-Design

HyggeRelaxElements - 4

Wandern des Mannschattenbildes PNG-Design

Wandern des Mannschattenbildes

Vintage-Luftschiff-Grafikdesign PNG-Design

Sleek and minimalist, this design features a vintage airship rendered in a bold dark blue against a light gray background

Grüne Waldlandschaft mit Hirsch

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

Winterlandschaft mit Schnee und Bäumen

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

CustomizableBlanks_GeometricSanSerif_vinyl - 1 PNG-Design

CustomizableBlanks_GeometricSanSerif_vinyl - 1

Campingabzeichen

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Camping-Silhouetten-Muster-Design

Nahtlose Muster

Check this great camping tileable pattern design including different camping elements like tents, lamps, wild animals and more! Edit and use this tileable pattern design for your design projects, wallpapers, backgrounds and more

Flache Bergwaldlandschaft

Flat landscape illustration featuring lots of mountains and woods

Karikaturkreuzfahrt die auf dem Meer reist

Cartoon Cruise traveling on the sea

Buntes Design des Skis

This beautiful and colorful design show a man skiing making a jump

9 Reiseembleme

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Flache Wüste Sonnenuntergang Illustration

Flat sunset illustration featuring a desert with cactus

Strand Sonnenuntergang Illustration

Flat sunset illustration featuring a beach with palm trees

Sonnenuntergang Strand Illustration

Flat sunset illustration featuring a beach with palm trees

Gebirgsnaturlandschaft

Illustrated nature landscape featuring mountains trees and clouds

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Flache Berglandschaftsgestaltung

Flat winter landscape illustration featuring lots of mountains snow and woods

Silhouette wandern PNG-Design

Silhouette wandern

von 33

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch