Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

491 abenteuer Vektor Designs für T-Shirts und Merch

Downloade & kaufe bearbeitbare abenteuer AI Vektorgrafiken für T-Shirts, Telefonhüllen, Buchcovers und andere Artikel Merch

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VEXELS15

Abenteuerliches Faultier-T-Shirt-Design

Charming t-shirt design of a sloth ready for adventure, equipped with a backpack and walking stick

Lustiges Wanderer-Zitat-T-Shirt-Design

Editierbarer Text

A black t-shirt design with the phrase "Be nice to hikers they know places you'll never be found" in bold, white letters

T-Shirt-Design mit Kanu-Flusslandschaft

Cool t-shirt design with a canoe in line art style, floating on a serene blue lake surrounded by trees and hills

Entwurfsvorlage für Roadtrip-Tagebuch KDP

Editierbarer Text

Amazing kdp interior featuring a road trip planner with a weekly and daily itinerary in line art

Skibrillen-T-Shirt-Design

Cool t-shirt design with a mountain reflection in ski goggles

Skifahrendes Pinguin-T-Shirt-Design

Cute t-shirt design with an animated penguin enjoying skiing, perfect for winter sport enthusiasts

Skateboard-Kunst-T-Shirt-Design

Editierbarer Text

Captivating t-shirt design with the quote; "Skateboarding: The Art of Defying Gravity"

Langlauf-T-Shirt-Design

Editierbarer Text

Intriguing t-shirt design with a Nordic deity motif merged with a skiing theme, and the text "Pray for Snow"

Waldläufer-T-Shirt-Design

Eye-catching t-shirt design depicting a man running through a forest with a dramatic, moody atmosphere

Totenkopf im Giftflaschen-T-Shirt-Design

Charming t-shirt design featuring an animated scene of sea creatures around a skull inside a poison bottle

Dschungelabenteuer-T-Shirt-Design für Kinder

Adorable t-shirt design featuring a child in a jungle setting, perfect for young adventurers and explorers

DnD Würfel Schatz Handyhülle Design

Seamless phone case design featuring repeating pixeled patterns of treasure chests and D20 dice on a blue background, inspired by tabletop roleplaying games

T-Shirt-Design mit Retro-Sonnenuntergang-Offroad-Abzeichen

Editierbarer Text

Dynamic t-shirt design featuring a retro sunset and offroad vehicle, perfect for adventure seekers

Astronauten-Weltraumabenteuer-T-Shirt-Design

Vibrant t-shirt design depicting an astronaut in a swirl of cosmic colors, symbolizing the thrill of space adventure

Mann im japanischen T-Shirt-Design eines Bootes

Beautiful t-shirt design, featuring a man sitting in a boat, with the sun shining behind him

Downhill Biking T-Shirt Design

T-shirt design featuring a downhill biker and the quote saying DOWHILL IS MY THRILL

Wohnmobil handgezeichnetes T-Shirt-Design

Editierbarer Text

Awesome black and white design featuring a hand-drawn camper van parked on the beach, and the quote "Home is where you park it"

Geboren um T-Shirt Design zu reisen

Amazing t-shirt design that features an illustration of a map in watercolor style with the quote "Born to travel"

Abenteuer erwartet Outdoor Experience T-Shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Astronaut auf Fahrrad-Weltraum-T-Shirt-Design

Intriguing t-shirt design featuring an astronaut riding a bike in space

Mountainbike-Vintage-T-Shirt-Design

Retro-styled t-shirt design with a mountain bike theme

Abenteuerliches Piratenpapageien-T-Shirt-Design

Funny t-shirt design featuring an adventurous pirate parrot with a playful expression, evoking a sense of daring and excitement

Bring mich zu Bergen T-Shirt Design

Amazing t-shirt design featuring the quote "Take me to the mountains"

Abenteuerliches Katzenkletter-T-Shirt-Design

Whimsical t-shirt design depicting a cat in a backpack climbing a colorful rock wall

Monochromer Taucher mit Blasen-T-Shirt-Design

Whimsical t-shirt design depicting an astronaut in scuba gear floating through space bubbles

T-Shirt-Design mit Reiseabzeichen

Vintage-inspired t-shirt design featuring a travelers badge with customizable text areas

Utah Klettern T-Shirt Design

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Lustiges Schneebrillen-T-Shirt Design

T-shirt design featuring snow goggles with a mountain on top of it and a smile under it

Abenteuerliches Bergmädchen-T-Shirt-Design

Editierbarer Text

Rustic t-shirt design featuring a hand-drawn mountain range above stylized serif text reading Wander GIRL

Lass uns Ski-T-Shirt-Design fahren

Editierbarer Text

Dynamic t-shirt design showcasing an intrepid skier

Sieben Gipfel Berg T-Shirt Design

T-shirt design featuring the seven highest mountain summits

Tauch-T-Shirt-Design für kleine Jungen

Playful t-shirt design with a cartoon of a boy pretending to dive in a bathtub

Stiefel für Wander-T-Shirt Design

Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Paragliding Sonnenuntergang T-Shirt Design

Beautiful t-shirt design that features a person paragliding during the sunset

Ihr eigener Weg T-Shirt Design

Editierbarer Text

Nice t-shirt design featuring the quote "Go your own way" and wooden signs with different captions

Sansibar-Surfer-T-Shirt-Design

Editierbarer Text

Cool t-shirt design that features a surfboard and palmtrees

Vintage-Cowboy- und LKW-T-Shirt-Design

Captivating t-shirt design with a classic western scene featuring a cowboy and vintage truck

T-Shirt-Design der US-Nationalparks

Editierbarer Text

Cool editable t-shirt design featuring a map of the United States with al the national parks

Sexy und im Freien T-Shirt Design

Great t-shirt design featuring a car towing a caravan with a retro background

Astronaut fährt ein Motorrad-T-Shirt-Design

Eye-catching t-shirt design showcasing an astronaut riding a motorcycle, combining the thrill of space exploration with the excitement of the open road

Entdecken Sie das unbekannte Berg-T-Shirt-Design

Editierbarer Text

Cool t-shirt that features a t-shirt design that reads "Explore the unknown" in bold letters against a mountain background

Monster-Truck-Blaze-T-Shirt-Design

Eye-catching t-shirt design featuring a monster truck ablaze with action

Detailliertes Piratengesicht-T-Shirt-Design

Captivating t-shirt design portraying a detailed pirate face with a menacing look and pirate hat

Fantasy-Würfel-T-Shirt-Design

Artistic t-shirt design with fantasy dice surrounded by floral elements

Alien-Sonnenuntergang-T-Shirt-Design

Dynamic t-shirt design showcasing an alien with a stunning sunset backdrop, set against a landscape of city towers and palm trees

Majestätisches Winterlandschafts-T-Shirt-Design

Dramatic t-shirt design showcasing a majestic winter landscape

Wandern Landschaft Elemente T-Shirt Design

T-shirt design featuring a hiking landscape with a backpack and minimalist hiking shoes

Red Hood Snowboard T-Shirt Design

T-shirt design feauring an illustration of Red Hood snowboarding out of a Wolf-like snow mountain

Geboren, um das T-Shirt-Design zu erforschen

Cool t-shirt design featuring a plane flying across the globe along with the quote "born to #explore"

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

von 10

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch