Registrieren
Einloggen
Vexels Logo
All
Zufällige Suche

1928 abenteuer Vektor Designs für T-Shirts und Merch

Downloade & kaufe bearbeitbare abenteuer AI Vektorgrafiken für T-Shirts, Telefonhüllen, Buchcovers und andere Artikel Merch

Gesponserte Ergebnisse vonShutterstock Logo
Erhalten Sie 15% Rabatt mit dem Code: VEXELS15
Seeker man illustration

Wir haben keine abenteuer Vektoren, aber hier sind alle unsere abenteuer Designs oder Design hier anfordern

Vintage-Design für Bergwasserflaschen PNG-Design

Premiumcrown icon
Playful illustration of a mountain-themed water bottle with a bold tree logo

Nautisches Leuchtturmdesign mit Wellen- und Bullaugenmotiv PNG-Design

Premiumcrown icon
Vibrant t-shirt design featuring a lighthouse framed by a porthole and crashing wave

Geboren um T-Shirt Design zu reisen

for Mercht-shirt icon
Druckfertig
Amazing t-shirt design that features an illustration of a map in watercolor style with the quote "Born to travel"

Verspieltes Design der Wasserflasche mit Naturmotiven PNG-Design

Premiumcrown icon
Vibrant illustration of a water bottle surrounded by trees and mountains, featuring a distinctive logo

Sieben Gipfel Berg T-Shirt Design

for Mercht-shirt icon
Druckfertig
T-shirt design featuring the seven highest mountain summits

Minimalistisches Design mit Berg- und Haustierumrissen PNG-Design

Premiumcrown icon
Elegant poster design featuring a figure and cat silhouetted against mountains

Paragliding Sonnenuntergang T-Shirt Design

for Mercht-shirt icon
Druckfertig
Beautiful t-shirt design that features a person paragliding during the sunset

Utah Klettern T-Shirt Design

for Mercht-shirt icon
Druckfertig
T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Nur noch ein Zitat zum Lesen eines Kapitels, halb flach PNG-Design

Nur noch ein Zitat zum Lesen eines Kapitels, halb flach

Farbenfrohes, skurriles Charakterdesign mit übergroßem Hut und Bart, T-Shirt-Design PNG-Design

Premiumcrown icon
Charming digital illustration of a gnome with a long beard and a pointy hat

Familien Road Trip Palmen Design PNG-Design

Familien Road Trip Palmen Design

Abenteuer erwartet Outdoor Experience T-Shirt Design

for Mercht-shirt icon
Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Von der Natur inspiriertes Wasserflaschendesign mit Berg- und Nachthimmelmotiven PNG-Design

Premiumcrown icon
Charming sticker design featuring a yellow water bottle with a nature motif and a moonlit backdrop

Vintage Leuchtturm nautisches Design PNG-Design

Premiumcrown icon
Bold emblem design featuring a lighthouse, waves, and rope elements

Illustration einer Zaubertrankflasche im Vintage-Stil PNG-Design

Premiumcrown icon
Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Stilisiertes nautisches Grafikdesign mit Leuchtturm und Seevogel PNG-Design

Premiumcrown icon
Classic emblem style graphic showcasing a lighthouse and seagull within a ship's wheel

Nautisches Leuchtturmdesign mit Steuerrad PNG-Design

Premiumcrown icon
Playful illustration featuring a lighthouse and waves within a ship's wheel

Flaschenabzeichen im Vintage-Stil PNG-Design

Premiumcrown icon
Playful badge design featuring a vintage-style bottle with artistic details and iconography

Illustrationsdesign im Vintage-Stil: Leuchtturm und Steuerrad auf See PNG-Design

Premiumcrown icon
Charming poster design featuring a lighthouse, seagull, and nautical wheel elements

Vintage-Design für Wanderwasserflaschen PNG-Design

Premiumcrown icon
Playful sticker design featuring a vintage-style water bottle and mountain elements

Aufwendig gestaltete Waffe mit Haken und Ketten PNG-Design

Premiumcrown icon
Bold illustration showcasing intricately designed hooks connected by chains

Einzigartiges Flaschendesign mit Bergmotiv PNG-Design

Premiumcrown icon
Playful sticker design featuring a bottle with a mountain logo and a plant accent

Stilisierte Illustration einer Vintage-Flasche PNG-Design

Premiumcrown icon
Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

Verspieltes Flaschendesign im Vintage-Stil PNG-Design

Premiumcrown icon
Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

Vintage-Illustration einer Camping-Wasserflasche mit Naturelementen PNG-Design

Premiumcrown icon
Playful sticker design featuring a yellow water bottle with a tree logo and natural accents

Niedliches, verspieltes Charakterdesign mit geflochtenem Haar und übergroßem Hut ? T-Shirt-Design PNG-Design

Premiumcrown icon
Charming digital illustration featuring a whimsical gnome with braided hair and a large hat

Downhill Biking T-Shirt Design

for Mercht-shirt icon
Druckfertig
T-shirt design featuring a downhill biker and the quote saying DOWHILL IS MY THRILL

Farbenfrohes, skurriles Gnome-Charakterdesign PNG-Design

Premiumcrown icon
Whimsical digital illustration of a gnome with a large hat and bushy beard

Verspieltes Gnome-Charakterdesign mit Winterthema PNG-Design

Premiumcrown icon
Charming gnome illustration featuring a friendly expression and cozy attire

Illustration einer skurrilen Fantasiefigur mit gemütlichem Hutdesign PNG-Design

Premiumcrown icon
Charming cartoon character design featuring a whimsical wizard with a cozy hat and flowing robe

Stiefel für Wander-T-Shirt Design

for Mercht-shirt icon
Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Charmantes T-Shirt-Design mit winkendem Gnom. PNG-Design

Premiumcrown icon
Charming gnome design featuring a whimsical green hat and round belly, perfect for festive themes

Charmantes, skurriles Charakterdesign mit leuchtenden Farben und verspielten Details ? T-Shirt-Design PNG-Design

Premiumcrown icon
Charming digital illustration of a whimsical gnome with a big beard and colorful hat

Verspielte Gnome-Illustration in leuchtenden Farben für ein fröhliches Design PNG-Design

Premiumcrown icon
Charming cartoon gnome design featuring a whimsical hat and curly beard

Wohnmobil handgezeichnetes T-Shirt-Design

for Mercht-shirt icon
Editierbarer Text
Druckfertig
Awesome black and white design featuring a hand-drawn camper van parked on the beach, and the quote "Home is where you park it"

T-Shirt-Design mit skurriler Figur und farbenfrohem Hut PNG-Design

Premiumcrown icon
Charming illustration of a gnome wearing a pink hat and flowing robe, featuring intricate beard details

Verspielte Gnome-Illustration mit farbenfrohem Hutdesign PNG-Design

Premiumcrown icon
Charming cartoon gnome with a bright hat and whimsical features, perfect for playful themed items

Verspielte Charakterillustration mit einem Gnom mit buntem Hut ? T-Shirt-Design PNG-Design

Premiumcrown icon
Charming digital art featuring a quirky gnome with a long beard and oversized hat

Niedliche Gnomfigur mit Herzballon-Illustration für T-Shirt-Design PNG-Design

Premiumcrown icon
Charming illustration featuring a gnome with a heart balloon, perfect for festive designs

Bring mich zu Bergen T-Shirt Design

for Mercht-shirt icon
Druckfertig
Amazing t-shirt design featuring the quote "Take me to the mountains"

Niedliches Gnom-Motiv mit buntem Hut ? T-Shirt-Design PNG-Design

Premiumcrown icon
Charming digital illustration of a gnome with a long beard and whimsical hat

T-Shirt-Design mit skurriler Illustration einer Figur mit grünem Hut PNG-Design

Premiumcrown icon
Charming illustration of a gnome with a tall hat, detailed beard, and friendly pose

Verspielte Charakterillustration mit übergroßem Hut ? T-Shirt-Design PNG-Design

Premiumcrown icon
Charming gnome illustration featuring a whimsical hat and a long beard

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

T-Shirt-Design mit skurriler Illustration einer bärtigen Figur mit Strohhut PNG-Design

Premiumcrown icon
Charming character design featuring a gnome with a straw hat and cheerful expression

Verspieltes Gnomen-Charakterdesign mit Strohhut PNG-Design

Premiumcrown icon
Adorable illustration featuring a whimsical gnome with a straw hat and long beard

Charmantes T-Shirt-Design mit Illustration einer Volksfigur mit Strohhut PNG-Design

Premiumcrown icon
Charming character design featuring a whimsical gnome with a straw hat and beard

Lassen Sie uns den Farbstrich des Zitats lesen PNG-Design

Lassen Sie uns den Farbstrich des Zitats lesen

Verspieltes Charakterdesign mit Strohhut und fließendem Gewand (T-Shirt-Design) PNG-Design

Premiumcrown icon
Whimsical design featuring a wizard with a straw hat and flowing beard, perfect for illustrations or merchandise

ATV Fahrer schwarz PNG-Design

ATV Fahrer schwarz
von 39
Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch
PLÄNE ANSEHEN