Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

433 wandern PSD T-Shirt Designs und Mockups

Downloade bearbeitbare wandern PSD T-Shirt Designs oder Mockups

Meinten Sie: lantern ?

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VXL15

Seeker man illustration

Wir haben keine wandern PSDs, aber hier sind alle unsere wandern Designs oder Design hier anfordern

Vintage-Bergabenteuer-T-Shirt-Design

Vintage-inspired t-shirt design with a mountain motif and the inspiring quote: "Conquer the summits, embrace the challenge"

Ich bin das beste lustige Zitat PNG-Design

Ich bin das beste lustige Zitat

T-Shirt-Design mit Bergforscher-Abzeichen

Adventurous t-shirt design featuring a badge with mountain peaks and the title "Mountain Explorer

Waldwandern und Vollmond-T-Shirt-Design

T-shirt featuring a forest design and full moon

Bergwanderer-T-Shirt-Design

Inspirational t-shirt design depicting a silhouetted hiker against a sunset, evoking adventure

Hier entlang zum See PNG-Design

Hier entlang zum See

Wanderreise-T-Shirt-Design

Editierbarer Text

Inspirational t-shirt design depicting a majestic mountain with the quote: "A journey in the mountains refreshes the soul"

Schritt für Schritt bringt uns näher T-Shirt-Design

Editierbarer Text

This t-shirt design features a man hiking up a mountain with a backpack on

Blauer Wanderzwerg PNG-Design

Blauer Wanderzwerg

Wanderpaar-Abenteuer-T-Shirt Design

Artistic t-shirt design featuring a hiking couple in mountain scenery with the quote: "Love in every mountain, adventure in every valley"

T-Shirt-Design mit Wander- und Erkundungszitat

Editierbarer Text

Inspirational t-shirt design showcasing a person hiking alongside the quote: "Explore beyond your limits"

Hund im Wald-T-Shirt-Design

Vintage style t-shirt design featuring a dog with a collar, standing in a landscape with mountains, trees and a lake, above the text "The woods are calling"

Zitieren Sie das Elch-Wander-T-Shirt-Design

A t-shirt design featuring an illustration of a cute moose, with intricate details and vibrant colors

Wanderndes Capybara-T-Shirt-Design

Adventurous t-shirt design of a bear ready for a hike, equipped with a backpack

Wanderstrich-Zitat PNG-Design

Wanderstrich-Zitat

Auf dem Gipfel T-Shirt Design

Editierbarer Text

Motivational t-shirt design with an adventurer and the message: "Find your peace at the summit"

Mit den Worten Wandern und Suchen darauf PNG-Design

A white with black text that reads "Hike and Seek" written across the front

Abenteuerrucksack-Design mit Campingelementen PNG-Design

Playful backpack design featuring rolled sleeping mat and hiking details

Malerische Laterne mit Berglandschaft PNG-Design

A unique and artistic illustration featuring a classic lantern with a serene mountain landscape inside

Wandern Winterferien

Simple design with mountain and 2 hikers and map with compass in vintage colors

Mountain Heartbeat Line Design

Design featuring a heartbeat line with a mountain in it

Frau die Silhouette wandert PNG-Design

Frau die Silhouette wandert

T-Shirt-Design für eine Schildkrötenwanderung

Editierbarer Text

Inspirational t-shirt design of a cartoon turtle carrying a backpack with the quote: Its the journey

Wanderlandschaft T-Shirt Design

Lovely t-shirt design that features a landscape and the silhouette of a hiker

Camp Haare interessieren sich nicht Lustiges Zitat Camping T-Shirt Design

Camp Hair Don't Care Funny Quote Camping T-shirt Design depicting a bonfire and a quote that says Camp Hair Don't Care perfect for camping hiking and outdoor activities

Cartoon-Einhorn-Wander-T-Shirt-Design

Funny t-shirt design featuring a cartoon unicorn peeing on a mountain

Lustiges Wanderer-Zitat-T-Shirt-Design

Editierbarer Text

A black t-shirt design with the phrase "Be nice to hikers they know places you'll never be found" in bold, white letters

Lustiges Schneebrillen-T-Shirt Design

T-shirt design featuring snow goggles with a mountain on top of it and a smile under it

Drachenwander-T-Shirt-Design

Cool t-shirt design featuring a dragon character with a hiking backpack on

Wanderfrosch T-Shirt Design

Great t-shirt design that includes an illustration of a frog hiking

Abenteuerliches Faultier-T-Shirt-Design

Charming t-shirt design of a sloth ready for adventure, equipped with a backpack and walking stick

Wanderndes deutsches lustiges Zitat-T-Shirt Design

Inhalt auf Deutsch

T-shirt design of people hiking through the mountains and a quote in German saying ICH WERDE NICHT AUFGEBEN ABER ICH WEERDE DEN GANZEN WEG FLUCHEN (I WON'T GIVE UP BUT I'LL SWEAR THE WHOLE WAY) Can be used on t-shirts hoodies mugs posters and any other merchandise

Outdoor Wandern Silhouette PNG-Design

Outdoor Wandern Silhouette

Wanderwald T-Shirt Design

Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Wanderer im Wald-T-Shirt-Design

Adventure-themed t-shirt design featuring a silhouette of a hiker in a forest landscape, appealing to trekkers

Sieben Gipfel Berg T-Shirt Design

T-shirt design featuring the seven highest mountain summits

Hearback Wander Silhouette PNG-Design

Hearback Wander Silhouette

Dog Trekking T-Shirt Design

T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Great Wilderness Quote T-Shirt Design

T-shirt design featuring a mountain landscape with the quote THE GREAT WILDERNESS

Wanderndes Alien-T-Shirt-Design

Eerie t-shirt design depicting an alien hiking in the woods in a nocturnal setting

Wandern des Mannschattenbildes PNG-Design

Wandern des Mannschattenbildes

Faultier Wanderclub T-Shirt Design

Awesome t-shirt design featuring cartoon sloths with the caption "Sloth hiking club"

Bergpaar Zitat T-Shirt Design

T-shirt design featuring a couple silhouette walking towards a mountain and a quote saying TAKE ME TO THE MOUNTAIN

Verspieltes Lagerfeuer-Grafikdesign PNG-Design

Vibrant campfire design featuring mountains, flames, and a sun motif

Wanderndes deutsches lustiges T-Shirt Design

Inhalt auf Deutsch

Awesome hiking t-shirt design that reads Ich werde nicht aufgeben aber ich werde die ganze zeit fluchen (i won't give up but i will swear all the time)

Wanderer Landschaft Natur T-Shirt Design

Lovely t-shirt design featuring a person hiking in a landscape with mountains, river and trees

Silhouette im Freien wandern PNG-Design

Silhouette im Freien wandern

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Liebesmomente zitieren T-Shirt Design

Beautiful t-shirt design that features an illustration of a person hiking and the quote "Fall in love with moments"

Gebirgsnaturlandschaft

Illustrated nature landscape featuring mountains trees and clouds

von 9

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch