Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

1326 berg PSD T-Shirt Designs und Mockups

Downloade bearbeitbare berg PSD T-Shirt Designs oder Mockups

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VXL15

Seeker man illustration

Wir haben keine berg PSDs, aber hier sind alle unsere berg Designs oder Design hier anfordern

Vintage-Illustration einer Camping-Wasserflasche mit Naturelementen PNG-Design

T-Shirt-Design mit Wüstensilhouette, Wolken und Kakteen PNG-Design

Sleek poster design featuring stylized mountains, clouds, and a sun with a cactus silhouette

Stilisierte Illustration einer Vintage-Flasche PNG-Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

T-Shirt-Design mit geometrischer Bergsilhouette, Wolken und Sonnenelementen PNG-Design

Sleek mountain illustration featuring stylized peaks and clouds, ideal for nature enthusiasts

Öko-Naturlandschaft

T-Shirt-Design: Silhouette eines Rucksacktouristen vor Sonnenuntergang und Bergkulisse PNG-Design

Dynamic illustration featuring a hiker against stylized mountains and sun

T-Shirt-Design mit stilisierter, monochromer Wüstenlandschaft und Kakteen PNG-Design

Stylish poster design featuring abstract cacti and rolling hills in a minimalist style

Person, die Retro-Sonnenuntergang-T-Shirt-Design radfährt

Editierbarer Text

Cool t-shirt design featuring a person riding a bike against a mountain and retro sunset background with the quote "Cicyling at dawn"

Great Smoky Mountains Nationalpark T-Shirt Design

Awesome t-shirt design featuring a bear against a mountain and tree landscape and the quote "Great smoky mountains"

Landform Berg flach schwarz PNG-Design

Landform Berg flach schwarz

T-Shirt-Design ?Berge unter der Sonne?.

Editierbarer Text

Cool t-shirt design featuring a mountain, the sun and a road

3 Skisportlabels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Skispringer Wintersport T-Shirt Design

Amazing t-shirt design featuring a person skiing down a mountain

Gebirgssilhouette-Logo eingestellt

Bergsteigermannplakat

This poster shows the silhouette of a man climbing a mountain with other mountains covered in snow behind him

Tragen Sie geometrisches T-Shirt Design

Nice nature theme t-shirt design featuring a bear in the forest with water reflection and the moon above made with geometric shapes

Offroad-Gebirgsstraßen-LKW-T-Shirt-Design

Cool t-shirt design showing an off road truck and a view of the mountains beside it

Hass Menschen T-Shirt Design

Camping retro themed t-shirt design featuring an illustration of a camping site on a circular frame with "I hate people" caption

3D Mountain Stroke T-Shirt Design

T-shirt design featuring a mountain landscape done with strokes

Wildnis Liebe T-Shirt Design

Nature themed T-shirt design showing a view of the mountains with a big "Wilderness" and "love" caption in different font styles

Abtupfendes Yeti-Sonnenuntergang-lustiges Meme-T-Shirt Design

Dabbing Yeti Sunset Funny T-shirt Design depicting a yeti doing a dab in front of a retro sunset

Flache Bergwaldlandschaft

Flat landscape illustration featuring lots of mountains and woods

Viking Compass T-Shirt Design

Viking Compass T-shirt Design featuring a detailed illustration of a viking compass with viking symbols on it an some mountains and moon on its back

Bergsteigen im Sonnenuntergang-Silhouette-T-Shirt-Design

T-shirt design featuring the silhouette of someone climbing a mountain

T-Shirt-Design mit Bergsteiger-Silhouette und Sonnenuntergangsszene PNG-Design

Dynamic poster design featuring a climber on a rock face with a scenic background

Satz isolierter Bergillustrationen

Set of mountain illustrations in different tones and shapes

Campingabzeichen

Camping is such a fun thing! This travelling badge features a mountain and a tent in the nature over a wood vector background

Mann mit Metalldetektor-Silhouette-T-Shirt-Design

Nice t-shirt design featuring a silhouette of a man using a meta detector in front of a mountain and lake

Bergsteigen-T-Shirt-Design

T-shirt design featuring the silhouette of someone climbing a mountain

Glückliches Wohnmobil-T-Shirt Design

Cool camping theme t-shirt design featuring a "Happy camper" caption the A letter is replaced with a tent with various camping elements scattered around Genial diseno de camiseta con tema de acampada con una leyenda "Feliz campista" la letra A se reemplaza por una tienda de campana con varios elementos de acampada esparcidos alrededor O design legal de uma camiseta com o tema camping com a legenda "Campista feliz" a letra A foi substituida por uma barraca com varios elementos de acampamento espalhados ao redor Cooles T-Shirt-Design zum Thema Camping mit der Aufschrift "Happy Camper"

Abenteuer erwartet Outdoor Experience T-Shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Japanisches traditionelles Landschaftsplakatdesign

Amazing poster design featuring a traditional japanese landscape with mount fuji and a temple

Flache Berglandschaftsgestaltung

Flat winter landscape illustration featuring lots of mountains snow and woods

T-Shirt-Design: Silhouette eines Bergsteigers vor Sonnenuntergang PNG-Design

Dynamic graphic design featuring a climber against stylized mountains and a sunset

Snowboard Sport Athlet T-Shirt PSD

Amazing t-shirt psd that features a person snowboarding with the quote "Snow and mountain"

Wintergebirgslandschaftsillustration

Flat illustration featuring a field with some trees and mountains on the horizon

Anime-Snowboard-T-Shirt-Design

Cool t-shirt design featuring an anime boy character snowboarding down a mountain

Camp mehr T-Shirt Design

Cool mountain camping t-shirt design featuring a tent with pine trees behind and "Camp more - worry less" caption

Mountain Love T-Shirt Design

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Reise-Lifestyle-Line-Art-Telefonkasten-Set

Editierbarer Text

Cool phone case set that features scenes about traveling like a backpack and a mountain

Isolierter Bergillustrationssatz

Set of mountain illustrations in different shapes and tones

Lebensabenteuer Wandern T-Shirt Design

Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Bunte Striche Seattle Skyline

This is a very artistic way to show the great city of Seattle; all covered painted in crazy colors with a blue mountain behind

Smoky Mountains T-Shirt Design

T-shirt design about Smoky Mountains featuring a road pines and a rocky landscape in a sunset and the words SMOKY MOUNTAINS

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

2015 Jahr der Ziege Polygon Poster

Polygonal background poster to celebrate a New Year showing a goat silhouette on a mountain

Utah Klettern T-Shirt Design

T-shirt design featuring a climber in a mountainous landscape with the words UNFORGETTABLE UTAH

Straßenreiseillustration

Beautiful road landscape illustration with a road going around a forest to the mountain sun

Weihnachtsmann-Ski-Weihnachtshintergrund

Its a funny background showing a big headed Santa Claus in cartoon style doing ski on a snowy mountain with a message of I Believe in Santa written

Wanderer und Kletterer Menschen Silhouette Set

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch