Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

433 wandern Grafikendesigns für T-Shirt und Print On Demand Merch

Downloade wandern T-Shirt Designs und andere Merch-Grafiken wie Buchcovers, Handyhüllen, Tragetaschen und mehr.

Meinten Sie: lantern ?

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VXL15

T-Shirt-Design mit Wander- und Erkundungszitat

Editierbarer Text

Inspirational t-shirt design showcasing a person hiking alongside the quote: "Explore beyond your limits"

Hund im Wald-T-Shirt-Design

Vintage style t-shirt design featuring a dog with a collar, standing in a landscape with mountains, trees and a lake, above the text "The woods are calling"

Vintage-Bergabenteuer-T-Shirt-Design

Vintage-inspired t-shirt design with a mountain motif and the inspiring quote: "Conquer the summits, embrace the challenge"

Auf dem Gipfel T-Shirt Design

Editierbarer Text

Motivational t-shirt design with an adventurer and the message: "Find your peace at the summit"

Outdoor Wandern Silhouette PNG-Design

Outdoor Wandern Silhouette

Bergsteigen Wandern PNG-Design

Bergsteigen Wandern

Mountain Heartbeat Line Design

Design featuring a heartbeat line with a mountain in it

Frau die Silhouette wandert PNG-Design

Frau die Silhouette wandert

T-Shirt-Design mit Bergforscher-Abzeichen

Adventurous t-shirt design featuring a badge with mountain peaks and the title "Mountain Explorer

Wanderfrosch T-Shirt Design

Great t-shirt design that includes an illustration of a frog hiking

Wanderlandschaft T-Shirt Design

Lovely t-shirt design that features a landscape and the silhouette of a hiker

Stiefel für Wander-T-Shirt Design

Cool hiking t-shirt design featuring the quote a????These boots are made for hikinga???? and an illustration of a backpack hiking boots and a bottle of water over a mountain landscape

Wanderwald T-Shirt Design

Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Camp Haare interessieren sich nicht Lustiges Zitat Camping T-Shirt Design

Camp Hair Don't Care Funny Quote Camping T-shirt Design depicting a bonfire and a quote that says Camp Hair Don't Care perfect for camping hiking and outdoor activities

Lustiges Wanderer-Zitat-T-Shirt-Design

Editierbarer Text

A black t-shirt design with the phrase "Be nice to hikers they know places you'll never be found" in bold, white letters

Schritt für Schritt bringt uns näher T-Shirt-Design

Editierbarer Text

This t-shirt design features a man hiking up a mountain with a backpack on

Cartoon-Einhorn-Wander-T-Shirt-Design

Funny t-shirt design featuring a cartoon unicorn peeing on a mountain

Waldwandern und Vollmond-T-Shirt-Design

T-shirt featuring a forest design and full moon

Lustiges Schneebrillen-T-Shirt Design

T-shirt design featuring snow goggles with a mountain on top of it and a smile under it

Person, die gegen die Sonne wandert, T-Shirt-Design

Cool t-shirt design featuring a man hiking in a mountain against the sun

Zitieren Sie das Elch-Wander-T-Shirt-Design

A t-shirt design featuring an illustration of a cute moose, with intricate details and vibrant colors

Wanderpaar-Abenteuer-T-Shirt Design

Editierbarer Text

Artistic t-shirt design featuring a hiking couple in mountain scenery with the quote: "Love in every mountain, adventure in every valley"

Wanderndes deutsches lustiges Zitat-T-Shirt Design

Inhalt auf Deutsch

T-shirt design of people hiking through the mountains and a quote in German saying ICH WERDE NICHT AUFGEBEN ABER ICH WEERDE DEN GANZEN WEG FLUCHEN (I WON'T GIVE UP BUT I'LL SWEAR THE WHOLE WAY) Can be used on t-shirts hoodies mugs posters and any other merchandise

T-Shirt Design mit Erinnerungen an Bigfoot-Wanderungen

Editierbarer Text

Nostalgic t-shirt design featuring a silhouette of Bigfoot with text about long roads and great memories

Wandern des Mannschattenbildes PNG-Design

Wandern des Mannschattenbildes

Bergsteigen Wandern Illustration Abzeichen PNG-Design

Bergsteigen Wandern Illustration Abzeichen

Sieben Gipfel Berg T-Shirt Design

T-shirt design featuring the seven highest mountain summits

Wanderndes Capybara-T-Shirt-Design

Adventurous t-shirt design of a bear ready for a hike, equipped with a backpack

Hearback Wander Silhouette PNG-Design

Hearback Wander Silhouette

Great Wilderness Quote T-Shirt Design

T-shirt design featuring a mountain landscape with the quote THE GREAT WILDERNESS

Dog Trekking T-Shirt Design

T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Monochromatisches Poster mit Wanderlandschaft

Editierbarer Text

Beautiful poster design in monochromatic style featuring a natural landscape and a person hiking

Faultier Wanderclub T-Shirt Design

Awesome t-shirt design featuring cartoon sloths with the caption "Sloth hiking club"

Mit den Worten Wandern und Suchen darauf PNG-Design

A white with black text that reads "Hike and Seek" written across the front

Schildkröten-Cartoon-Tier-Wander-T-Shirt-Design

Fun t-shirt design featuring a turtle hiking and the quote "The mountain and the wild"

Schildkröten- und Faultier-Wander-T-Shirt Design

Fun t-shirt design of a sloth and turtle hiking with the quote "Turtloth hiking team

Zion Nationalpark USA T-Shirt-Design

Great t-shirt design featuring the Angels Landing hiking trail in Zion National Park, Utah

Camping Vintage T-Shirt Design

Editierbarer Text

Great t-shirt design that features a tent in the woods with the caption "1981" in vintage style

Silhouette im Freien wandern PNG-Design

Silhouette im Freien wandern

Bergpaar Zitat T-Shirt Design

T-shirt design featuring a couple silhouette walking towards a mountain and a quote saying TAKE ME TO THE MOUNTAIN

Bergsteigen Wandern Schnee PNG-Design

Bergsteigen Wandern Schnee

Wanderer Landschaft Natur T-Shirt Design

Lovely t-shirt design featuring a person hiking in a landscape with mountains, river and trees

Wanderndes deutsches lustiges T-Shirt Design

Inhalt auf Deutsch

Awesome hiking t-shirt design that reads Ich werde nicht aufgeben aber ich werde die ganze zeit fluchen (i won't give up but i will swear all the time)

Fluch den ganzen Weg T-Shirt Design

Inhalt auf Deutsch

Beautiful t-shirt design that features a man hiking and the german quote "Ich werde nicht aufgeben aber den ganzen Weg fluchen

Liebesmomente zitieren T-Shirt Design

Beautiful t-shirt design that features an illustration of a person hiking and the quote "Fall in love with moments"

Berge deutsches Zitat T-Shirt Design

Inhalt auf Deutsch

Great t-shirt design featuring a few mountains, with the German quote "The mountains are calling and I must go!"

Wandern Winterferien

Simple design with mountain and 2 hikers and map with compass in vintage colors

Wochenend Camping T-Shirt Design

T-shirt design featuring a girl looking through binoculars and the quote WEEKEND

Wanderbär T-Shirt Design

T-shirt design featuring a hiker bear

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch