Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

369 hiking Grafikendesigns für T-Shirt und Print On Demand Merch

Downloade hiking T-Shirt Designs und andere Merch-Grafiken wie Buchcovers, Handyhüllen, Tragetaschen und mehr.

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VEXELS15

Grafikdesign mit Abenteuersilhouette, Bergen und Sonne PNG-Design

Vibrant poster design featuring a hikers silhouette against a scenic mountain backdrop

Edit Online Badge

Online bearbeiten

Urlaubscamping-Design mit Weihnachtsmann und Lagerfeuer T-Shirt-Designvorlage

Playful t-shirt design showcasing Santa sitting by a campfire with the text 'Merry Miles on the Trail'

Detaillierte Illustration eines Stiefels im Militärstil PNG-Design

Sturdy illustration of classic military boots featuring intricate detailing and laces

Illustrationsdesign für auffällige Stiefel im Militärstil PNG-Design

Bold illustration of combat boots featuring intricate lacing and detailed textures

Stilvolles Tribal-Stiefelmuster PNG-Design

Unique boot print design showcases intricate tribal patterns for footwear aesthetics

Stilvolle Illustration von Details an Kampfstiefeln PNG-Design

Playful graphic design highlighting intricate details of combat boots

Stilvolle Illustration eines Vintage-Stiefels PNG-Design

Unique vintage boot design showcasing intricate lacing and detailed contours

Detaillierte Illustration eines Kampfstiefels PNG-Design

Sturdy boot design featuring intricate lacing details and a robust style

Detaillierte Laternenillustration mit Berglandschaft PNG-Design

Unique lantern design featuring a scenic mountain landscape inside

Öllampendesign mit malerischer Bergillustration PNG-Design

Charming illustration in a lantern showing mountains and a sun motif

Bunte Laterne mit malerischem Landschaftsdesign PNG-Design

Charming illustration of a camping lantern featuring a serene mountain landscape and river inside

Verspieltes Schuhgrafikdesign PNG-Design

Whimsical design featuring stylized legs in boots, creating a fun and quirky look

Charmante Illustration von Winterstiefeln PNG-Design

Playful graphic design of winter boots featuring fluffy cuffs and buckles

Illustration von kuscheligen Winterstiefeln PNG-Design

Charming illustration of winter boots, featuring a soft fur top and detailed laces

Stilvolles Design mit rotem Fußabdruck PNG-Design

Dynamic footprint design featuring bold red soles and striking star patterns

Einzigartiges Sneaker-Silhouette-Design PNG-Design

Minimalist sneaker design featuring a detailed outline of a shoe's sole

Stilvolles Schuhdruckdesign PNG-Design

Bold graphic design featuring detailed shoe prints with star patterns, perfect for apparel or merchandise

Unverwechselbares grafisches Design des Schuhsohlenmusters PNG-Design

Bold graphic design featuring detailed shoe prints, ideal for outdoor and adventure themes

Einzigartige Sneaker-Profilillustration PNG-Design

Stylish graphic design featuring a detailed sneaker footprint pattern

Einzigartiges Schuhdruck-Grafikdesign PNG-Design

Bold shoe print design featuring detailed tread patterns that showcase a rugged outdoor vibe

Edit Online Badge

Online bearbeiten

Vintages Bergzitatdesign T-Shirt-Designvorlage

Rustic and bold, this poster design features an engaging quote that reads, 'Die Berge Haben Mich Gerufen & Ich Muss Gehen!' The typography combines playful script and vintage-inspired fonts, showcasing a strong emphasis on the word 'Berge,' which translates to 'mountains

Kompassillustration zum Thema Abenteuer mit motivierendem Zitat PNG-Design

Playful compass design that serves as a poster illustration

Design einer Campingszene in den Bergen PNG-Design

This t-shirt design features a beautiful mountain camping scene with a tent, a campfire, and a moon in the background

Grüne Lampe mit Berglandschafts-Design PNG-Design

This t-shirt design features a green lamp with a mountain scenery inside

Mountain Love T-Shirt Design

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Bergsteiger PNG-Design

Bergsteiger

Bergetikettenabzeichen mit Sonne PNG-Design

Bergetikettenabzeichen mit Sonne

Grüne Waldlandschaft mit Hirsch

Flat landscape illustration featuring a forest with light coming through the tree branches and a deer silhouette

12 Reiseembleme

12 travel emblems including motivating messages

Schöne Vektor Fahrräder

Collection of 11 different people riding bicycles silhouettes with

Berge die T-Shirt Design nennen

Cool t-shirt design showing a badge with mountains illustration and "Mountains Are Calling" caption

Sieben Gipfel Berg T-Shirt Design

T-shirt design featuring the seven highest mountain summits

Winterlandschaft mit Schnee und Bäumen

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Abenteuer erwartet Outdoor Experience T-Shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Bergsteiger Silhouette 3 PNG-Design

Bergsteiger Silhouette 3

Flache Bergwaldlandschaft

Flat landscape illustration featuring lots of mountains and woods

9 Reiseembleme

Cool travel emblems with travel motivating messages like don't be a tourist be a traveler or travel the world

Eins mit dem Mountains T-Shirt Design

Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Flache Berglandschaftsgestaltung

Flat winter landscape illustration featuring lots of mountains snow and woods

Berglandschaftsillustrationsdesign

Flat illustration featuring moutains and their reflection

Bergsilhouette klettern PNG-Design

Bergsilhouette klettern

Dog Trekking T-Shirt Design

T-shirt design featuring a silhouette of a dog and its owner taking a hike in a mountainous landscape

Flache Naturlandschaftsgestaltung

Flat landscape illustration featuring lots of hills fields and woods

Waldlandschaftsillustration mit Schnee

Flat illustration featuring a forest with falling snow and bokeh

Illustration einer Waldlandschaft

Flat landscape illustration featuring lots of trees field and river

Great Wilderness Quote T-Shirt Design

T-shirt design featuring a mountain landscape with the quote THE GREAT WILDERNESS

Camping Landschaftsillustration mit Lagerfeuer

Flat landscape illustration featuring a forest with a person silhouette next to a dog and campfire

Wald- und Gebirgslandschaft mit Hirsch

Flat landscape illustration featuring lots of trees mountains and a deer

Berglandschaftsillustration

Flat illustration featuring moutains over a blue sky

von 8

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch