Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

4486 e sport Grafikendesigns für T-Shirt und Print On Demand Merch

Downloade e sport T-Shirt Designs und andere Merch-Grafiken wie Buchcovers, Handyhüllen, Tragetaschen und mehr.

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VEXELS15

Heben Sie wie ein Mädchen-T-Shirt-Design

Cool t-shirt design that features a strong girl and the quote "Lift like a girl"

T-Rex-Dinosaurier, der Fußball-T-Shirt-Design spielt

Amazing t-shirt design that features a t-rex dinosaur with a football ball against a rainbow

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Motocross Surf Skateboard Schlagzeuger Logos

Yes! Rock & Roll is an extreme sport

Paddel-Tennisschläger-Silhouette-Set

Amazing sport-themed set that features a series of silhouettes of paddle tennis racquets, all in different shape and sizes

Minigolf-Zwerge-T-Shirt-Design

Editierbarer Text

Amazing t-shirt design that features gnomes playing mini-golf and the quote "Mini golf squad"

Cooles amerikanisches Baseball-T-Shirt-Design

Great American t-shirt design with the quote "As American as baseball" and a baseball ball with two bats

American Football Spieler Silhouetten

8 American Football players silhouettes in different position running standing catching the ball and celebrating a goal

Pickleball-Evolution-T-Shirt-Design

An Evolution t-shirt design featuring a sequence of iconic images capturing the progress of evolution, from single-celled organism to a pickleball player

Skeleton Skater macht Stunt-T-Shirt psd

Cool t-shirt psd featuring a person with a skull for a head skateboarding and the quote "Skate your dreams"

Dieser arbeitet T-Shirt-Design aus

Check out this awesome training t-shirt design featuring two hands and the quote 'This one is working out today'

Wanderwald T-Shirt Design

Hiking Forest T-Shirt Design featuring a woman hiking deep in the forest with her dog and some beautiful trees and birds in the background scene

Laufende Männer T-Shirt Design

Running Men T-Shirt Design featuring some men running a marathon with the phrase Just Keep Going

Bühnenbild für American-Football-Spieler

Amazing character set, one player is sending the pass and the other running for a catch

Schmutzmotorrad-T-Shirt Entwurf des Schmutzes

Cool t-shirt design that features a biker riding a motorcycle in front of a US flag

Bowling Retro-Aufkleber-Set

Awesome set of retro bowling stickers

Sensenmann Skater T-Shirt Design

T-shirt design featuring the Grim Reaper riding a skateboard

Tennis-Schmutz-Farbt-shirt Entwurf

T-shirt design featuring a male tennis player and the word TENNIS designed in grunge color style

6 Extremsportabzeichen

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Pickleball Opa lustiger Zitat-T-Shirt Entwurf

Editierbarer Text

Fun t-shirt design that features the quote "Some grandpas play bingo but badass grandpas play pickleball"

Frauen, die Jiu-Jitsu-Kampfkunst-T-Shirt-Design machen

Awesome t-shirt design featuring two women doing jiu jitsu

Paddleboard Herzschlag T-Shirt Design

Amazing t-shirt design depicting a man doing paddleboarding between the lines of a heartbeat

Basketball-Abzeichen-Design-Set

Awesome badge set design that features eight different basketball badges in the colors orange white and blue

Rugby-Elemente eingestellt

Awesome rugby set that features different rugby elements such as a rugby ball a field a goal post and more" all in black and white

Petanque Spiel T-Shirt Design

Awesome t-shirt design that includes an illustration of a man playing petanque in silhouette style with the word Boule on top of it

Tischtennis Menschen Silhouette Pack

Silhouette pack featuring 4 table tennis players in different poses

Fahrzeuge-Icon-Set

Kanuelemente ausgeschnittenes Set

Amazing set design that features different canoes and kayaks in cut-out style

Tennis T-Rex T-Shirt-Design

Tennis T-Rex T-Shirt Design featuring a Dinosaur playing a Tennis match having some trouble with his short arms! Can be used on t-shirts hoodies mugs posters and any other merchandise

Surfing California Dreaming Schriftzug

Cool Summer themed lettering design featuring "Surfing" caption with palm or coconut trees silhouette and "California Dreaming" caption at the bottom

6 Sportabzeichen Embleme

This set of sport badges emblems or insignias feature sport balls with the name of the sport

20 Rugby-Silhouetten eingestellt

Set with 20 silhouettes of rugby players doing different moves kicking the ball fighting for it running jumping etc

Cooles Fahrradtransport T-Shirt Design

Editierbarer Text

Amazing t-shirt design that features a bike as a quote that reads "Cool"

Wasserball Schwimmer Ente T-Shirt Design

Cool t-shirt design featuring a duck in a swimming cap about to play water polo

Disc Golf T-Shirt Design

Amazing t-shirt design featuring disc golf elements in retro style

Cricket Evolution T-Shirt Design

Great t-shirt design that features an illustration of human evolution ending with a cricketer and the phrase "Cricket evolution"

USA-Flaggen-Fußball-T-Shirt-Design

Cool t-shirt design that features a soccer ball and an American flag in distressed style

Skiberge T-Shirt-Design

Editierbarer Text

Amazing t-shirt design that features mountains and ski silhouettes with the quote "Republic of cool"

Ski-Silhouette-T-Shirt-Design

Editierbarer Text

Amazing t-shirt design that features a ski silhouette and retro colors

Retro-Ski-T-Shirt-Design

Check this awesome ski t-shirt design including a colorful retro design of a person skiing! Use this print ready design for t-shirts, posters, mug, hoodies and other merch products

Boxer-Hundebox-T-Shirt-Design

Funny and cute t-shirt design that features a boxer dog wearing boxing gloves

Frau spielt Bowling-T-Shirt-Design

Awesome t-shirt design featuring a woman playing bowling

Lustiges Golf-Zitat-T-Shirt-Design

T-shirt design featuring a golf ball cartoon next to a hole and a text saying I'D TAP THAT

Silhouette Trophy Pack

A set of several trophy medals announce and place desk in black silhouette style artwork

Snowboarder Mann T-Shirt Design

Incredible t-shirt design that includes a snowboarder man, in high contrast style

Französische Bulldogge Mädchen T-Shirt Design

T-shirt design featuring a lovely illustration of a female French Bulldog doing a mimic of the We Can Do It poster

Aquarell Rugbyball T-Shirt Design

Awesome t-shirt design featuring a rugby ball in watercolor style with colorful splashes around

Berg Hearbeat Illustration

Mountain Heartbeat design featuring a heartbeat illustration with a mountain in the middle

Baseball-Tupfen-T-Shirt-Design

Amazing t-shirt design that features a baseball ball dabbing in retro cartoon style

Gewichtheben Bär T-Shirt Design

Look at this awesome GYM t-shirt design of a weightlifting bear! Can be used on t-shirts, hoodies, and any other merchandise

von 90

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch