Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

1326 berg Logo Design Vorlagen

Downloade bearbeitbare berg Logo Design Vorlagen

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VXL15

Seeker man illustration

Wir haben keine berg Logos, aber hier sind alle unsere berg Designs oder Design hier anfordern

Flaschenabzeichen im Vintage-Stil PNG-Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

T-Shirt-Design mit Wüstensilhouette, Wolken und Kakteen PNG-Design

Sleek poster design featuring stylized mountains, clouds, and a sun with a cactus silhouette

Verspieltes Flaschendesign im Vintage-Stil PNG-Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

T-Shirt-Design mit geometrischer Bergsilhouette, Wolken und Sonnenelementen PNG-Design

Sleek mountain illustration featuring stylized peaks and clouds, ideal for nature enthusiasts

Hass Menschen T-Shirt Design

Camping retro themed t-shirt design featuring an illustration of a camping site on a circular frame with "I hate people" caption

T-Shirt-Design: Silhouette eines Rucksacktouristen vor Sonnenuntergang und Bergkulisse PNG-Design

Dynamic illustration featuring a hiker against stylized mountains and sun

T-Shirt-Design mit stilisierter, monochromer Wüstenlandschaft und Kakteen PNG-Design

Stylish poster design featuring abstract cacti and rolling hills in a minimalist style

Person, die Retro-Sonnenuntergang-T-Shirt-Design radfährt

Editierbarer Text

Cool t-shirt design featuring a person riding a bike against a mountain and retro sunset background with the quote "Cicyling at dawn"

Great Smoky Mountains Nationalpark T-Shirt Design

Awesome t-shirt design featuring a bear against a mountain and tree landscape and the quote "Great smoky mountains"

Landform Berg flach schwarz PNG-Design

Landform Berg flach schwarz

T-Shirt-Design ?Berge unter der Sonne?.

Editierbarer Text

Cool t-shirt design featuring a mountain, the sun and a road

3 Skisportlabels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Campingabzeichen

Camping is such a fun thing! This travelling badge features a mountain and a tent in the nature over a wood vector background

Gebirgssilhouette-Logo eingestellt

Bergsteigermannplakat

This poster shows the silhouette of a man climbing a mountain with other mountains covered in snow behind him

Glückliches Wohnmobil-T-Shirt Design

Cool camping theme t-shirt design featuring a "Happy camper" caption the A letter is replaced with a tent with various camping elements scattered around Genial dise?o de camiseta con tema de acampada con una leyenda "Feliz campista" la letra A se reemplaza por una tienda de campa?a con varios elementos de acampada esparcidos alrededor O design legal de uma camiseta com o tema camping com a legenda "Campista feliz" a letra A foi substitu?da por uma barraca com v?rios elementos de acampamento espalhados ao redor Cooles T-Shirt-Design zum Thema Camping mit der Aufschrift "Happy Camper"

Flache Bergwaldlandschaft

Flat landscape illustration featuring lots of mountains and woods

Satz isolierter Bergillustrationen

Set of mountain illustrations in different tones and shapes

Tragen Sie geometrisches T-Shirt Design

Nice nature theme t-shirt design featuring a bear in the forest with water reflection and the moon above made with geometric shapes

Offroad-Gebirgsstraßen-LKW-T-Shirt-Design

Cool t-shirt design showing an off road truck and a view of the mountains beside it

Öko-Naturlandschaft

Detaillierte Silhouette des Vulkanberges PNG-Design

Detaillierte Silhouette des Vulkanberges

Vintage-Illustration einer Camping-Wasserflasche mit Naturelementen PNG-Design

Bergsteigen-T-Shirt-Design

T-shirt design featuring the silhouette of someone climbing a mountain

T-Shirt-Design mit Bergsteiger-Silhouette und Sonnenuntergangsszene PNG-Design

Dynamic poster design featuring a climber on a rock face with a scenic background

Abtupfendes Yeti-Sonnenuntergang-lustiges Meme-T-Shirt Design

Dabbing Yeti Sunset Funny T-shirt Design depicting a yeti doing a dab in front of a retro sunset

Mann mit Metalldetektor-Silhouette-T-Shirt-Design

Nice t-shirt design featuring a silhouette of a man using a meta detector in front of a mountain and lake

Wintergebirgslandschaftsillustration

Flat illustration featuring a field with some trees and mountains on the horizon

Bergsteigen im Sonnenuntergang-Silhouette-T-Shirt-Design

T-shirt design featuring the silhouette of someone climbing a mountain

Abenteuer erwartet Outdoor Experience T-Shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Flache Berglandschaftsgestaltung

Flat winter landscape illustration featuring lots of mountains snow and woods

Japanisches traditionelles Landschaftsplakatdesign

Amazing poster design featuring a traditional japanese landscape with mount fuji and a temple

Stilisierte Illustration einer Vintage-Flasche PNG-Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

T-Shirt-Design: Silhouette eines Bergsteigers vor Sonnenuntergang PNG-Design

Dynamic graphic design featuring a climber against stylized mountains and a sunset

Snowboard Sport Athlet T-Shirt PSD

Amazing t-shirt psd that features a person snowboarding with the quote "Snow and mountain"

Wanderer und Kletterer Menschen Silhouette Set

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Anime-Snowboard-T-Shirt-Design

Cool t-shirt design featuring an anime boy character snowboarding down a mountain

Isolierter Bergillustrationssatz

Set of mountain illustrations in different shapes and tones

Mountain Love T-Shirt Design

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Skispringer Wintersport T-Shirt Design

Amazing t-shirt design featuring a person skiing down a mountain

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Straßenreiseillustration

Beautiful road landscape illustration with a road going around a forest to the mountain sun

Reise-Lifestyle-Line-Art-Telefonkasten-Set

Editierbarer Text

Cool phone case set that features scenes about traveling like a backpack and a mountain

Camp mehr T-Shirt Design

Cool mountain camping t-shirt design featuring a tent with pine trees behind and "Camp more - worry less" caption

Offroad-Logo-Vorlagen-Set

Bunte Striche Seattle Skyline

This is a very artistic way to show the great city of Seattle; all covered painted in crazy colors with a blue mountain behind

Bergziege inspirierendes T-Shirt

T-shirt design depicting a daring mountain goat jumping over an abyss and a quote that says 'Conquer Your Fears'

Winterlandschaft mit Schnee und Bäumen

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

2015 Jahr der Ziege Polygon Poster

Polygonal background poster to celebrate a New Year showing a goat silhouette on a mountain

Weihnachtsmann-Ski-Weihnachtshintergrund

Its a funny background showing a big headed Santa Claus in cartoon style doing ski on a snowy mountain with a message of I Believe in Santa written

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch