Preise
Registrieren
Einloggen
Vexels Logo

120 klettern Vektoren & Grafiken zum Download

Downloade klettern bearbeitbare Vektorgrafiken für jede Designprojekt. In AI, SVG, PNG, JPG und PSD.
Gesponserte Ergebnisse vonShutterstock Logo
Erhalten Sie 15% Rabatt mit dem Code: VXL15

Mountain Climber Adventure Lifestyle T-Shirt Design

for Mercht-shirt icon
Adventure Lifestyle T-shirt design depicting a climber going up a mountain bare handed with a bag of powder and the quote "No Risk No Reward"

Kinder spielen Character Pack

Premiumcrown icon
Character pack featuring 4 kids playing and doing different activities

Wanderer und Kletterer Menschen Silhouette Set

Premiumcrown icon
People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Eins mit dem Mountains T-Shirt Design

for Mercht-shirt icon
Cool T-shirt design featuring a mountain silhoutte over a red and black backdrop and One with the Mountains' caption

Berg Hearbeat Illustration

Mountain Heartbeat design featuring a heartbeat illustration with a mountain in the middle

Retro Camping Logos und Wanderabzeichen Embleme

Set of 9 nice retro Logo Badges to use for outdoors activities like hiking camping mountaineering climbing and nature adventure

Mountain Love T-Shirt Design

for Mercht-shirt icon
Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Lassen Sie uns Real High T-Shirt Design bekommen

for Mercht-shirt icon
Cool t-shirt design showing a mountain illustration with a Let's Get Real High Caption

Für immer ein Bergsteiger-T-Shirt Design

for Mercht-shirt icon
Druckfertig
Cool t-shirt design featuring an illustration of a tough man with crossed arms and an angry face over a????Forever a mountaineera???? lettering

T-Shirt mit Katzenwirbelsäule

for Mercht-shirt icon
Druckfertig
Cool t-shirt design that includes various cats climbing on ribs

Retro-Wander- und Camping-Label-Abzeichen

This cool set includes label and badges for camping outdoor hiking climbing and other adventure activities

Affe Zahnbürste T-Shirt Design

for Mercht-shirt icon
Druckfertig
Cool t-shirt design featuring a monkey with the quote "Climb like a monkey brush like a dentist"

Ziel High Mountain T-Shirt Design

for Mercht-shirt icon
T-shirt design featuring the silhouette of someone climbing a mountain

T5 Geocaching T-Shirt Design

for Mercht-shirt icon
Druckfertig
Amazing t-shirt design that features the quote "T5 Geocaching" with stickmen climbing and canoeing

Campingabzeichen

Cool set of camping outdoors hiking and climbing badges over black background in one color that can be customized

Bergsteigen-T-Shirt-Design

Premiumcrown icon
T-shirt design featuring the silhouette of someone climbing a mountain

Berge warten T-Shirt Design

for Mercht-shirt icon
Cool Black and white T-shirt design with a mountain over the clouds illustration

Komm weg mit mir T-Shirt Design

for Mercht-shirt icon
Cool t-shirt design with a mountain illustration and a "Come Away With Me" caption

Für immer Bergsteiger T-Shirt Design

for Mercht-shirt icon
Druckfertig
Cool t-shirt design featuring an illustration of a mountaineer with a????Forever a mountaineera???? quote in black letters over a yellow background

Cooles T-Shirt-Design der Bergsteiger

for Mercht-shirt icon
T-shirt design featuring the silhouette of someone climbing a mountain

Bergschattenbild-T-Shirt Design

for Mercht-shirt icon
T-shirt design featuring the silhouette of someone climbing a mountain

Berg-Silhouette-Icon-Set

Mountain icon set featuring 16 mountain designs in silhouette style

Abenteuer erwartet T-Shirt Design

for Mercht-shirt icon
Simple travel t-shirt design featuring mountain peaks over sky with clouds backdrop in hexagon frame with "Adventure awaits" caption

Bibliothek Katzen T-Shirt Design

for Mercht-shirt icon
Druckfertig
Lovely t-shirt design that features an illustration of cats climbing a bookshelf

Bergsteigen im Sonnenuntergang-Silhouette-T-Shirt-Design

for Mercht-shirt icon
T-shirt design featuring the silhouette of someone climbing a mountain

Abstrakte Berglogoschablone

Abstract mountain logo template design featuring a blue mountain

Camping Illustrationen gesetzt

Set of two camping illustrations featuring forest and mountain landscapes

Camping Illustrationen Pack

Set of two camping illustrations featuring forest and mountain landscapes

Abstraktes Gebirgslogoschablonendesign

Label or logo design featuring a mountain silhouette in tones of blue and gray

Kletterndes T-Shirt Design der niedlichen fetten Katze

for Mercht-shirt icon
Druckfertig
Cute t-shirt design featuring a cat that tries to climb along the shirt

Illustrationsset für Landschaften im Freien

Premiumcrown icon
Set of two illustrations featuring a forest and icy mountain landscape

2 im Freien Wald Illustration Banner oder Rahmen

Set of two camping illustrations featuring forest landscapes

Mountain Label Abzeichen Vorlage

Label or badge design featuring a mountain silhouette in tones of green and blue

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Spielplatz Klettergerüst Illustration

Premiumcrown icon
Colorful kids playground illustration of play towers with slides and climbing frame

Faultier wildes Tier wirft niedliches Set auf

Premiumcrown icon
Adorable character set in color-stroke that features several sloths doing different activities such as sleeping, walking, climbing and more

Bergsteigen Silhouetten gesetzt

Mountain climbing silhouettes set

Hipster-Berg-Logo-Vorlage

Label or logo template design featuring a mountain silhouette in tones of blue and gray

Faultier Tier wirft niedlichen Musterentwurf auf

Premiumcrown icon
Nahtlose Muster
Cute pattern design featuring sloths in different activities, such as climbing, walking and sleeping

Action Feuerwehrmann posiert

Various vector designs in this set depicting a fireman in action poses

Urlaub Reise Fotos Hintergrund

Background with several photos of landmarks and landscapes around the world placed over a parchment

30 Sportkreissymbole

This set has 30 icons of many different sports represented as silhouettes within colored circles

2 Im Freien Berg Illustration Banner oder Rahmen

Set of two illustrations featuring forest and mountain landscapes

6 Extremsportabzeichen

If you practice extreme sports you are going to love these six badges for using in promos images for stores and brands or any material related to mountaineering and winter sports

Man klettert Treppensequenzrahmenrahmenschattenbilder

Man climbing stairs sequence frames silhouettes

Fotojournalist mit Bildern auf der ganzen Welt

Female photojournalist with pictures around the world

28 Quadratische Symbole für Sport-Silhouetten

This set has 28 icons of many different sports represented as silhouettes within yellow squares

Strich Berg T-Shirt Design

for Mercht-shirt icon
Cool mountain theme t-shirt design featuring stroke lines looking like mountain over grunge stripes backdrop

6 Logo-Vorlagen für Bergabzeichen

Set of mountain labels or badges

Illustriertes Camping-Set

Set of two camping illustrations featuring mountain and forest landscapes
Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch
PLÄNE ANSEHEN