Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

635 berg Vektoren & Grafiken zum Download

Downloade berg bearbeitbare Vektorgrafiken für jede Designprojekt. In AI, SVG, PNG, JPG und PSD.

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VXL15

3 Skisportlabels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Mountain Adventure Ad Banner Set

Editierbarer Text

Awesome ad banner set fearuting mountain landscapes

Hass Menschen T-Shirt Design

Camping retro themed t-shirt design featuring an illustration of a camping site on a circular frame with "I hate people" caption

Person, die Retro-Sonnenuntergang-T-Shirt-Design radfährt

Editierbarer Text

Cool t-shirt design featuring a person riding a bike against a mountain and retro sunset background with the quote "Cicyling at dawn"

Great Smoky Mountains Nationalpark T-Shirt Design

Awesome t-shirt design featuring a bear against a mountain and tree landscape and the quote "Great smoky mountains"

Berge-Emblem-Logo-Vorlage

Vollständiges Branding

T-Shirt-Design ?Berge unter der Sonne?.

Editierbarer Text

Cool t-shirt design featuring a mountain, the sun and a road

Skispringer Wintersport T-Shirt Design

Amazing t-shirt design featuring a person skiing down a mountain

Gebirgssilhouette-Logo eingestellt

Transparentes Strichset für wilde Tiere

Awesome set of wild animals in a stroke style

Flache Bergwaldlandschaft

Flat landscape illustration featuring lots of mountains and woods

Tragen Sie geometrisches T-Shirt Design

Nice nature theme t-shirt design featuring a bear in the forest with water reflection and the moon above made with geometric shapes

Offroad-Gebirgsstraßen-LKW-T-Shirt-Design

Cool t-shirt design showing an off road truck and a view of the mountains beside it

3D Mountain Stroke T-Shirt Design

T-shirt design featuring a mountain landscape done with strokes

Logovorlage für Berglandschaftsbilder

Vollständiges Branding

Wildnis Liebe T-Shirt Design

Nature themed T-shirt design showing a view of the mountains with a big "Wilderness" and "love" caption in different font styles

Bergsteigermannplakat

This poster shows the silhouette of a man climbing a mountain with other mountains covered in snow behind him

Abtupfendes Yeti-Sonnenuntergang-lustiges Meme-T-Shirt Design

Dabbing Yeti Sunset Funny T-shirt Design depicting a yeti doing a dab in front of a retro sunset

Wildtier-Doppelbelichtungs-Stroke-Elemente

Awesome set of nature elements with double exposure stroke landscapes

Mann mit Metalldetektor-Silhouette-T-Shirt-Design

Nice t-shirt design featuring a silhouette of a man using a meta detector in front of a mountain and lake

Reise-Lifestyle-Line-Art-Telefonkasten-Set

Editierbarer Text

Cool phone case set that features scenes about traveling like a backpack and a mountain

Glückliches Wohnmobil-T-Shirt Design

Cool camping theme t-shirt design featuring a "Happy camper" caption the A letter is replaced with a tent with various camping elements scattered around Genial diseno de camiseta con tema de acampada con una leyenda "Feliz campista" la letra A se reemplaza por una tienda de campana con varios elementos de acampada esparcidos alrededor O design legal de uma camiseta com o tema camping com a legenda "Campista feliz" a letra A foi substituida por uma barraca com varios elementos de acampamento espalhados ao redor Cooles T-Shirt-Design zum Thema Camping mit der Aufschrift "Happy Camper"

Logo für Berglandschaftskleidung

Editierbarer Text

Abenteuer erwartet Outdoor Experience T-Shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Flache Berglandschaftsgestaltung

Flat winter landscape illustration featuring lots of mountains snow and woods

Satz isolierter Bergillustrationen

Set of mountain illustrations in different tones and shapes

Logo Template Elements Set

Wanderer und Kletterer Menschen Silhouette Set

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Mountain Love T-Shirt Design

Cool T-shirt design featuring a mountain silhoutte over a yellow orange sun illustration

Öko-Naturlandschaft

Gestaltung von Urlaubsbroschüren

Editable design featuring flat illustrations showing different types of vacations

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Bergsteigen im Sonnenuntergang-Silhouette-T-Shirt-Design

T-shirt design featuring the silhouette of someone climbing a mountain

Camp mehr T-Shirt Design

Cool mountain camping t-shirt design featuring a tent with pine trees behind and "Camp more - worry less" caption

Verschiedene Business-Logo-Set

Campingabzeichen

Camping is such a fun thing! This travelling badge features a mountain and a tent in the nature over a wood vector background

Lebensabenteuer Wandern T-Shirt Design

Cool hiking t-shirt design featuring three hikers with the caption a????The adventure of your lifea????

Bunte Striche Seattle Skyline

This is a very artistic way to show the great city of Seattle; all covered painted in crazy colors with a blue mountain behind

2015 Jahr der Ziege Polygon Poster

Polygonal background poster to celebrate a New Year showing a goat silhouette on a mountain

Stier-Energie-T-Shirt-Design

Editierbarer Text

Playful t-shirt design featuring the phrase 'Taurus Energy' in bold, playful typography

Weihnachtsmann-Ski-Weihnachtshintergrund

Its a funny background showing a big headed Santa Claus in cartoon style doing ski on a snowy mountain with a message of I Believe in Santa written

Wintergebirgslandschaftsillustration

Flat illustration featuring a field with some trees and mountains on the horizon

Isolierter Bergillustrationssatz

Set of mountain illustrations in different shapes and tones

T-Shirt Design mit alpinem Leben

Editierbarer Text

The t-shirt design features a man skiing on a mountain with the words Alpine Life written above it

Straßenreiseillustration

Beautiful road landscape illustration with a road going around a forest to the mountain sun

Offroad-Logo-Vorlagen-Set

Bergziege inspirierendes T-Shirt

T-shirt design depicting a daring mountain goat jumping over an abyss and a quote that says 'Conquer Your Fears'

Illustration von Bergen und Blumen, inspiriert von der Natur

Elegant t-shirt design featuring a flower, mountains, and a sun motif

Winterlandschaft mit Schnee und Bäumen

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Bergsteigen-T-Shirt-Design

T-shirt design featuring the silhouette of someone climbing a mountain

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch