Design-Bibliothek

Design-Tools

Ressourcen

Unternehmenslösungen

Registrieren

Einloggen

1328 berg Vektoren & Grafiken zum Download

Downloade berg bearbeitbare Vektorgrafiken für jede Designprojekt. In AI, SVG, PNG, JPG und PSD.

Gesponserte Ergebnisse von Shutterstock Logo

Erhalten Sie 15% Rabatt mit dem Code: VXL15

Seeker man illustration

Wir haben keine berg Vektoren, aber hier sind alle unsere berg Designs oder Design hier anfordern

Verspieltes Vintage-Design für Ahornsirupflaschen PNG-Design

T-Shirt-Design mit Wüstensilhouette, Wolken und Kakteen PNG-Design

Sleek poster design featuring stylized mountains, clouds, and a sun with a cactus silhouette

Verspieltes Flaschendesign im Vintage-Stil PNG-Design

Charming illustration of a bottle with a unique lid and emblem, set in a dynamic geometric shape

T-Shirt-Design mit geometrischer Bergsilhouette, Wolken und Sonnenelementen PNG-Design

Sleek mountain illustration featuring stylized peaks and clouds, ideal for nature enthusiasts

Hass Menschen T-Shirt Design

Camping retro themed t-shirt design featuring an illustration of a camping site on a circular frame with "I hate people" caption

Flaschenillustration im Vintage-Stil mit Naturmotiven PNG-Design

Playful poster design featuring a vintage bottle, complemented by nature elements, perfect for outdoor enthusiasts

T-Shirt-Design mit stilisierter, monochromer Wüstenlandschaft und Kakteen PNG-Design

Stylish poster design featuring abstract cacti and rolling hills in a minimalist style

Person, die Retro-Sonnenuntergang-T-Shirt-Design radfährt

Editierbarer Text

Cool t-shirt design featuring a person riding a bike against a mountain and retro sunset background with the quote "Cicyling at dawn"

T-Shirt-Design: Silhouette eines Rucksacktouristen vor Sonnenuntergang und Bergkulisse PNG-Design

Dynamic illustration featuring a hiker against stylized mountains and sun

Great Smoky Mountains Nationalpark T-Shirt Design

Awesome t-shirt design featuring a bear against a mountain and tree landscape and the quote "Great smoky mountains"

T-Shirt-Design ?Berge unter der Sonne?.

Editierbarer Text

Cool t-shirt design featuring a mountain, the sun and a road

Landform Berg flach schwarz PNG-Design

Landform Berg flach schwarz

Campingabzeichen

Camping is such a fun thing! This travelling badge features a mountain and a tent in the nature over a wood vector background

3 Skisportlabels

Set with 3 labels or badges showing a person doing ski on a snowy mountain two of them have a triangular shape with rounded corners and the other is completely round; two of them also has ribbons with Skiing written

Gebirgssilhouette-Logo eingestellt

Flache Bergwaldlandschaft

Flat landscape illustration featuring lots of mountains and woods

Bergsteigermannplakat

This poster shows the silhouette of a man climbing a mountain with other mountains covered in snow behind him

Verspieltes Flaschendesign im Vintage-Stil mit Naturelementen PNG-Design

Charming bottle illustration featuring a unique design, accented with natural motifs

T-Shirt-Design mit Bergsteiger-Silhouette und Sonnenuntergangsszene PNG-Design

Dynamic poster design featuring a climber on a rock face with a scenic background

Satz isolierter Bergillustrationen

Set of mountain illustrations in different tones and shapes

Mann mit Metalldetektor-Silhouette-T-Shirt-Design

Nice t-shirt design featuring a silhouette of a man using a meta detector in front of a mountain and lake

Öko-Naturlandschaft

Wintergebirgslandschaftsillustration

Flat illustration featuring a field with some trees and mountains on the horizon

Abenteuer erwartet Outdoor Experience T-Shirt Design

Cool T-shirt design featuring a view of the mountains with a moon silhouette behind

Bergsteigen-T-Shirt-Design

T-shirt design featuring the silhouette of someone climbing a mountain

Flache Berglandschaftsgestaltung

Flat winter landscape illustration featuring lots of mountains snow and woods

Farbenfrohes, von der Natur inspiriertes Flaschenillustrationsdesign PNG-Design

Charming bottle design features a scenic sun and clouds, highlighting nature's beauty

Abtupfendes Yeti-Sonnenuntergang-lustiges Meme-T-Shirt Design

Dabbing Yeti Sunset Funny T-shirt Design depicting a yeti doing a dab in front of a retro sunset

T-Shirt-Design: Silhouette eines Bergsteigers vor Sonnenuntergang PNG-Design

Dynamic graphic design featuring a climber against stylized mountains and a sunset

Bergsteigen im Sonnenuntergang-Silhouette-T-Shirt-Design

T-shirt design featuring the silhouette of someone climbing a mountain

Wanderer und Kletterer Menschen Silhouette Set

People silhouette set featuring climbers and hikers in different actions; includes rocks and mountain parts

Isolierter Bergillustrationssatz

Set of mountain illustrations in different shapes and tones

Japanisches traditionelles Landschaftsplakatdesign

Amazing poster design featuring a traditional japanese landscape with mount fuji and a temple

Verspieltes Design der Wasserflasche mit Naturmotiven PNG-Design

Extremsport-Silhouette-Sammlung

Sport silhouette collection featuring various people performing extreme sports like paraglidingskydivingkayakinghikingmountain climbingsurfing and skiing

Snowboard Sport Athlet T-Shirt PSD

Amazing t-shirt psd that features a person snowboarding with the quote "Snow and mountain"

Straßenreiseillustration

Beautiful road landscape illustration with a road going around a forest to the mountain sun

Anime-Snowboard-T-Shirt-Design

Cool t-shirt design featuring an anime boy character snowboarding down a mountain

Illustration einer Zaubertrankflasche im Vintage-Stil PNG-Design

Playful graphic design featuring a potion bottle with a unique tree emblem and decorative elements

Offroad-Logo-Vorlagen-Set

Skispringer Wintersport T-Shirt Design

Amazing t-shirt design featuring a person skiing down a mountain

Flaschenabzeichen im Vintage-Stil PNG-Design

Playful badge design featuring a vintage-style bottle with artistic details and iconography

Reise-Lifestyle-Line-Art-Telefonkasten-Set

Editierbarer Text

Cool phone case set that features scenes about traveling like a backpack and a mountain

Bergziege inspirierendes T-Shirt

T-shirt design depicting a daring mountain goat jumping over an abyss and a quote that says 'Conquer Your Fears'

Vintage-Illustration einer Camping-Wasserflasche mit Naturelementen PNG-Design

Bunte Striche Seattle Skyline

This is a very artistic way to show the great city of Seattle; all covered painted in crazy colors with a blue mountain behind

Winterlandschaft mit Schnee und Bäumen

Flat illustration featuring a winter landscape with silhouettes of trees and lots of snow

Stilisierte Illustration einer Vintage-Flasche PNG-Design

Charming digital illustration of a vintage bottle with a nature motif, complemented by a leaf and stone detail

2015 Jahr der Ziege Polygon Poster

Polygonal background poster to celebrate a New Year showing a goat silhouette on a mountain

Weihnachtsmann-Ski-Weihnachtshintergrund

Its a funny background showing a big headed Santa Claus in cartoon style doing ski on a snowy mountain with a message of I Believe in Santa written

Steigern Sie Ihr Geschäftmit der führenden Grafikplattform für Merch